Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "programming,"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

Random Sentences

1. Wives can also play a significant role in raising children and managing household affairs.

2. Tumingin siya sa akin, waring may nais siyang ipahiwatig.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. Ang takip-silim ay isang magandang panahon para mag-unwind at mag-isip-isip sa mga bagay-bagay.

5. Kulay pula ang libro ni Juan.

6. Tumawa siya. Thank you Jackz! See ya! Bye! Mwuaaahh!!

7. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

8. Mura lang pala ang bili nya sa kanyang damit.

9. Nabahala si Aling Rosa.

10. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

11. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

12. Dahil sa pagkabigla ay hindi na nakapagsalita ang binata at ito ay napaluha na lang.

13. Ang takip-silim ay isang magandang panahon upang magpahinga at magrelax mula sa mga pagod ng araw.

14. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

15. Pinagpalaluan ng mga empleyado ang kanilang manager dahil sa kanyang mahusay na pamumuno.

16. I sent my friend a bouquet of flowers and a card that said "happy birthday."

17. La motivation peut être influencée par la culture, les valeurs et les croyances de chacun.

18. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

19. Cancer is a complex disease, and ongoing research and collaboration are essential for developing new treatments and improving patient outcomes

20. The task of organizing the event was quite hefty, but we managed to pull it off.

21. Hindi dapat natin pahintulutan ang paglapastangan sa kapakanan ng mga batang nasa mapanganib na kalagayan.

22. Nakakuha kana ba ng lisensya sa LTO?

23. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

24. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

25. At habang umiisod ang pila, nararamdaman niyang lalong umiinit ang sikat ng araw.

26. They have been cleaning up the beach for a day.

27. Dahil malilimutin ang bata, iniwan niya ang kanyang takdang-aralin sa bahay.

28. Hindi ko akalaing capable ka palang tumawa.

29. Hockey is popular in many countries around the world, particularly in Canada, the United States, Russia, and Scandinavia.

30. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

31. Pwede ba akong pumunta sa banyo?

32. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

33. Yey! Thank you Jacky! The best ka talaga!

34. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

35. ¿Cómo te va?

36. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

37. Effective use of emphasis can enhance the power and impact of communication.

38. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

39. Walang makakibo sa mga agwador.

40. La vaccination est un moyen efficace de prévenir les maladies infectieuses et protéger la santé publique.

41. Sinalat niya ang kanyang bulsa ngunit wala roon ang kanyang cellphone.

42. Naku, ang taas pala ng temparatura ko.

43. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

44. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

45. Ang haba ng prusisyon.

46. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

47. Frustration can also be a symptom of underlying mental health issues such as anxiety or depression.

48. Malaki ang lungsod ng Makati.

49. Emphasis can also be used to create a sense of urgency or importance.

50. Saan ka galing? Dalawang araw na ako dito ah! aniya.

Recent Searches

sourceprogramming,specificeditorsystemsettingextraneverinternatooltechnologicalfacequalitywhypinakamahalagangmagpa-picturedegreestataynagpipiknikuniversitieshorsenapahintoiyamotimportantepasaheroalinfurvictoriasectionsyarimaatimnakipagpagbigyanlumulusobkrustutoringcomputersSapasoccerdaanbotebilerservicesnegativekahaponbilingcontinuenagbabakasyonnagtitiisnanghahapdikomunikasyonkakuwentuhandamitsumamabalitamapayapalimosstrengthnakikihukaycultivarhitsurajobsnag-aaralbangladeshpaki-translatecarsnanghihinanagpakitaanak-pawisnageenglishgayunmansapatosdelekare-karenalakikumakantadiretsahangdoble-karahiwatangekspagtawamagkasabaypagkapasokiintayinnamumulotiwinasiwassumakaypaghuniunanisinaraconclusion,hanapinnabigaylandassiguradomahirapalagangsurveyslikodumiwasintensidadhurtigereprimeroskasamahandilimlayuanbopolssiraentertainmentbisikletanabiglasahodhunikainanbanlagcurtainsnatalopaakyatgustongemphasizedmagkakaanakexcitedtulalaheartbreakkatapatkindsmatulisnaglabananayawyourself,natulakhagdanbaryokuwebapalakaproductsmanilayoutubemaarawbumotoosakamembersmanuksomalambingmaskijenamalumbayeclipxepatunayanpalangnahihilodenneganangatensyonggustoumigibyepkantolagiprinceiyongbukodninyopag-itimlaryngitissigamasseshouseaniyabasahinmininimizenitonunokonsiyertowalispakelamscientifichigitmulighedzoomvocalaccederdollysamfundmedievalsanlutofueitinalibipolarrosekalancuentanintroducecoaching:pulafertilizerotraspinggangran