Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "programming,"

1. Additionally, television has also been used as a tool for educational programming, such as Sesame Street, which has helped to teach young children reading, writing, and math

2. Additionally, the advent of streaming services like Netflix and Hulu has changed the way that people consume television, and this has led to the creation of a new form of television programming, known as binge-watching

3. Here are a few ideas to get you started: Freelancing: If you have a skill that others need, such as writing, graphic design, or programming, you can offer your services as a freelancer

Random Sentences

1. Alam mo ba kung bakit takot si Cross sa hospital?

2. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

3. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

4. Kunwa pa'y binangga mo ko, ano, ha? Magaling, magaling ang sistema ninyong iyan.

5. La vista desde la cima de la montaña es simplemente sublime.

6. Nasanay na siyang salatin ang dingding para maghanap ng switch ng ilaw.

7. Waring hindi pa tapos ang laban, kaya hindi kami dapat magpabaya.

8. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

9. We need to get this done quickly, but not by cutting corners.

10. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

11. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

12. Tila may nais siyang ipahiwatig sa kanyang mga kilos.

13. Pinaniniwalaang ang albularyo ay may kaalaman sa lihim na karunungan ng kagubatan.

14. Les soins de santé mentale de qualité sont essentiels pour aider les personnes atteintes de maladies mentales à vivre une vie saine et productive.

15. The culprit behind the vandalism was eventually caught and held accountable for their actions.

16. How I wonder what you are.

17. Disculpe; ¿me puede ayudar por favor?

18. The United States has been involved in many international conflicts, including World War I and World War II.

19. Ang Ibong Adarna ay isang sikat na kwento sa panitikang Filipino.

20. She is not playing the guitar this afternoon.

21. Do something at the drop of a hat

22. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

23. He has been repairing the car for hours.

24. Pumupunta siya sa Maynila bawat buwan.

25. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

26. The wedding photographer captures important moments and memories from the wedding day.

27. Ang mga tao ay nasiyahan sa nangyari.

28. La creatividad se puede aplicar en cualquier campo de trabajo.

29. Kapag mayroong sakit sa ngipin, kailangan mong magpakonsulta agad sa dentista.

30. Sino ang bumisita kay Maria?

31. Magandang maganda ang Pilipinas.

32. The value of stocks can rise or fall depending on a company's financial performance and market conditions.

33. Anong panghimagas ang gusto nila?

34. A lot of noise from the construction site disturbed our peace and quiet.

35. May mga nagpapaputok pa rin ng mga paputok sa hatinggabi kahit bawal na ito.

36. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

37. Ang pagmamalabis sa pagbili ng mga hindi kailangang bagay ay maaring magdulot ng financial stress.

38. In 1977, at the age of 42, Presley died of a heart attack

39. L'auto-discipline est également importante pour maintenir la motivation, car elle permet de s'engager dans des actions nécessaires même lorsque cela peut être difficile.

40. Ate Annika naman eh, gusto ko ng toy!

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Il est important d'avoir une compréhension des probabilités et des cotes lorsque l'on joue.

43. Lalo itong nalungkot nang malamang magdaraos ng isang handaan ang Adang kagubatan.

44. The bride and groom usually exchange vows and make promises to each other during the ceremony.

45. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

46. Mayroon ba kayo na mas malaking size?

47. They have studied English for five years.

48. Sa aming probinsya, makikita mo ang mga bukid na mayabong na mga tanim.

49. Tienes que tener paciencia para lograr buenos resultados.

50. You reap what you sow.

Recent Searches

programming,berkeleyuloreturnedhelpkinuhabatalanhawihapasinnaglalabataposdrogabangkangkitapookhinintayinorderhalinglingkasisutilwakasnakakunot-noongsanaynagtagisannanghingidiyannakapapasongpamburanakapagngangalitnegativenagawangiintayinnabalitaanerlindaintensidadmanahimikdisfrutarnakatalungkolandlinespendingalignspitonglighthigaansinabibarcelonapagbabantakisapmataberegningerunidoslangkaysinaydelserkainanbanlagorganizeinangself-defensepinalayasbumuhoshagdanbusyutilizarlinawedsaplacedisyempreitinagocivilizationvehiclesprogrammingmustcineutilizaaniyaoperahan18thcoachingmisusedresearch:tarangkahanhardresultworryfinishedinuminbeginningideadinalacigarettestudentsnaghuhukayautomaticoffentligbasasumalinagsisigawlumitawmatakasayawpalaisipanpinabayaangagawinmakitananahimikparehongmaglalakadmagpa-ospitalnanunuksogumawatahimiknagkasakitmahiyapagtiisanwasto1960smaghahandakamalayantamadmagdilimdalawinpagngitinamulatcarsmakakasahodkinukuyomnagtakainjurynapatayonagdiretsousuariopatakbopumayagkontinentengpaglulutonyanheartbreakpublicitysapilitanggreatlyorkidyaspinabulaannakatuonsapatospapuntangnatitirangtinikmanlalargana-curiouspaalammejokinaingodthikingbateryainakyatfionaiatfcelularesmalayangseniorburmagrewgiveipaliwanagdalawapunsosusunduinpersonaltherapyaywancommunitybumababagoodenchantedwatchpalagingoutlinespartnerresttopic,ipasokcountriesstreamingendfigureresponsiblestandchefdecreasejunjunbeyondreadnananaghilinakakapagpatibaynagpatuloyhongpsssbalahibocomplex