Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "condition"

1. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

2. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

3. He was also a philosopher, and his ideas on martial arts, personal development, and the human condition continue to be studied and admired today

4. High blood pressure, or hypertension, is a common condition that affects millions of people worldwide.

5. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

6. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

7. Patients may need to undergo tests, procedures, or surgeries during hospitalization to diagnose and treat their condition.

8. The patient's family history of high blood pressure increased his risk of developing the condition.

Random Sentences

1.

2. Another area of technological advancement that has had a major impact on society is transportation

3. Si Chavit ay may alagang tigre.

4. I have been taking care of my sick friend for a week.

5. Don't count your chickens before they hatch

6. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

7. Agad niya itong kinuha at isinaboy sa paligid ng salamangkera.

8. Understanding the biology of viruses is critical to developing effective treatments and vaccines, and to preventing future pandemics.

9. Nagluluto si Andrew ng omelette.

10. Jodie at Robin ang pangalan nila.

11. Ang kanyang mga salita ay nagbabaga ng inspirasyon sa mga nakikinig.

12. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

13. Scissors should be handled with care to avoid injuries and kept out of reach of children.

14. Kailangan ko ng lumisan mahal ko.

15. Medarbejdere kan arbejde på fuld tid eller deltidsbasis.

16. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

17. In the early days, telephones were connected to a central switchboard, which connected calls manually

18. Ang paglalakad sa kalikasan at pakikisalamuha sa kalikasan ay nakagagamot sa aking isip at katawan.

19. Hindi ko alam ang sagot, pero sa ganang iyo, ano ang dapat gawin sa sitwasyong ito?

20. The singer on stage was a beautiful lady with an incredible voice.

21. The flowers are not blooming yet.

22. Hindi sila makaangal sa di makatarungang pagpapautang.

23. Sa kanyang harap, pinagmamasdan niya ang mga kumikislap na bituin sa gabi.

24. Anong kailangan mo? pabalang kong tanong.

25. Excuse me, may I know your name please?

26. Nauntog si Jerome sa kanilang pintuan.

27. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

28. Las hierbas como el jengibre y la cúrcuma tienen propiedades antiinflamatorias y antioxidantes.

29. Hindi ko maaaring pabayaan ang aking mga agam-agam dahil ito ay maaaring magdulot ng panganib sa aking buhay.

30. Paano po kayo naapektuhan nito?

31. Acts of kindness, no matter how small, contribute to a more charitable world.

32. Gracias por hacer posible este maravilloso momento.

33. Sa panahon ng pandemya, yumabong ang paggamit ng mga online platforms para sa mga transaksiyon.

34. High blood pressure is more common in older adults and those with certain medical conditions.

35. Kapag lulong ka sa droga, mawawala ang kinabukasan mo.

36. Da Vinci tenía una gran curiosidad por la naturaleza y la ciencia.

37. Huwag mo nang papansinin.

38. Kung alam ko lang na ganito kasakit ang magiging parusa ko

39. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

40. Keep in mind that making money online takes time, effort, and patience

41. Tumango ako, you want? alok ko sa kanya.

42. Saan pumunta si Trina sa Abril?

43. The store has a variety of sizes available, from small to extra-large.

44. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

45. Me encanta el aroma fresco de las hierbas recién cortadas.

46. Nous avons prévu une séance photo avec nos témoins après la cérémonie.

47. She is learning a new language.

48. Ewan ko sayo, ikaw pinakamaarteng lalakeng nakilala ko.

49. Nang marinig ang tawag ng nanay niya, kumaripas ng uwi ang batang naglalaro sa labas.

50. Mag-usap tayo sa WhatsApp o Line.

Similar Words

conditioning

Recent Searches

conditionoffentligipinacrazyrelievedestablishedcirclebabadarkresponsiblekanilatechnologiesnakainomkuwebaumabotbitawanagilanapapag-usapankabarkadanapatulaladiagnosticpanghabambuhayfloorgawinluisadahilmagsalitacassandrawritebeybladecultivatedilagaydingdingkumukuhamananalotrajecontinuedbaonnahahalinhankalamalapitanbibigkalalakihanmagtatagalakmangimportantnakapapasongpagkakayakapmalezareserbasyonkahirapannagliliyabhumalakhaknasasakupanisinulatnegro-slavesnapakamotdoble-karapagtutolpagbatipakikipagbabagteachmakapagempakewatawatnapakalusogmaulinigannakahugmagdamaganinjurymahinoggumagamitkumustamasyadongpabulongsasakaypagkaawapinigilanmagsugalbalediktoryanmakauwitaraaffiliatemagisipmasaganangnatinagkastilangpwestosementongalas-dostrentabahagyangpromisepakistanunanminerviekassingulangnaglulusakumuponag-umpisathoughsuffertransportdyosabinawianbarongretirarkasihinahaploshinanaptamadsikipdadalococktailbagamahacershadescampaignsnakaphilippinepagputitamayeykontingrestawransalitanginterestsmatapospasalamatanconsumenag-replysumagotltohappeneddiladeteriorateattentionbranchsoccerailmentsindustryipaliwanagmournedlatestpostcarddinalawlimosgamotroomestaromeletteipagamotsciencepangulonotguestsdeathbilhinsatisfactionpotaenacreationinilingsquatterarmedmuchdinicontinueschefilingquicklycontrolledyeahtopicallowedroberteffectselevatortagpiangroofstockmarteshapasinnauwitenabsnagbagoaplicaresultagagamitpalantandaansaktannobodybilihinkumananrodonatelecomunicacionessinehanhinanakithonestodepartmenthoneymoonerspagpapakilala