Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "idea"

1. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

2. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

3. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

4. Individuals with baby fever may feel a strong urge to nurture and care for a child, experiencing a deep emotional connection to the idea of becoming a parent.

5. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

6. Let's just hope na magwork out itong idea ni Memo.

7. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

Random Sentences

1. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

2. Some people argue that it's better not to know about certain things, since ignorance is bliss.

3. Sa pag-aalala pala sa kapatid ay sumunod si Perla at kitang-kita niya nang mahulog siya sa ilog.

4. Have we completed the project on time?

5. Para relajarme, suelo hacer yoga o meditación como pasatiempo.

6. Magkamali ka, hindi makakatakas sa kanilang mga mata.

7. Ano ba pinagsasabi mo! Baliw ka ba! Umalis ka nga!

8. Sarado ang eskuwela sa Sabado at Linggo.

9. Bukas ay kukuha na ako ng lisensya sa pagmamaneho.

10. I've been driving on this road for an hour, and so far so good.

11. Ipantalop mo ng kamote ang kutsilyo.

12. Nag-aalalang sambit ng matanda.

13. Andyan kana naman.

14. Maaring ibigay ng guro ang libro sa akin.

15. Many cultures have their own unique traditions and customs surrounding weddings.

16. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

17. She has collaborated with several prominent artists, including The Weeknd, Nicki Minaj, and Lady Gaga.

18. Dahan-dahan niyang iniangat iyon.

19. Kailangan nating ipakita ang bukas palad na pagtanggap sa mga taong mayroong maling ginawa upang matututo sila.

20. The cutting of the wedding cake is a traditional part of the reception.

21. Lasinggero ang tatay ni Gabriel.

22. Bunga ng globalisasyon ang pag-unlad ng maraming industriya sa iba't-ibang bansa.

23. Pakibigay sa amin ang detalyeng kailangan para maayos naming magawa ang proyekto.

24. Punung-puno ng bunga ang puno, ngunit sobrang asim naman ng laman.

25. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

26. Natatandaan ko pa nung bata ako na nagtatawanan kami ng mga kaibigan ko habang kumakain ng pulotgata.

27. Ang bayanihan ay nagbibigay inspirasyon sa aming mga kabataan na maging aktibo at maging bahagi ng komunidad.

28. Omelettes are a popular choice for those following a low-carb or high-protein diet.

29. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

30. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

31. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

32. Los asmáticos a menudo experimentan tos como síntoma de un ataque de asma.

33. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

34. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

35. Kumain sa canteen ang mga estudyante.

36. The bridge was closed, and therefore we had to take a detour.

37. The telephone also played a role in the development of recorded music, as it allowed people to hear music over the phone

38. Hindi niya namalayan na tatlong oras na siyang tulala sa harap ng kanyang computer.

39. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

40. Hindi niya iningatan ang kanyang cellphone, samakatuwid, nasira ito agad.

41. Mahalaga ang listahan para sa mga malilimutin tulad ni Lita.

42. Las plantas acuáticas, como los nenúfares, se desarrollan y viven en el agua.

43. Sa mga lugar na mabundok, naglipana ang mga halaman na katangi-tangi sa kanilang ganda.

44. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

45. Bumuga siya ng hangin saka tumingin saken.

46. TikTok is a social media platform that allows users to create and share short-form videos.

47. Hospitalization may require patients to take time off from work or school, which can have financial and educational consequences.

48. "Ang pera ang ugat ng lahat ng kasamaan" ay isang bukambibig na nagsasabing ang pagkakaroon ng pera ang dahilan ng iba't ibang problema sa mundo.

49. Me encanta la comida picante.

50. Off the court, LeBron is actively involved in philanthropy through his LeBron James Family Foundation, focusing on education and providing opportunities for at-risk children.

Similar Words

ideasidea:

Recent Searches

ideastudentschambersislaspaghettithroughoutclassroompangilgagamitwalletpulabinabaanalamshowdolyarhumanosprogramming,sourceactivitymemoryconditioningthoughtsstandmetodeimproveumigtadiintayintatawagselebrasyonnakatagopanigkuwadernonasaankampanamaputlapaligsahanmaalikaboknagwalisbintananaguguluhangkalarosalatdedication,posterkumatokpag-unladnapakatagalnakatunghayvideos,pagpapatubomakakatakasmagpa-checkupkadalagahangnakakatawanageenglishtamanagtrabahonagpipiknikgayunmanmagnakawnangampanyanagkakakainanibersaryomerlindanakatuloghampaslupanakatalungkonakapasokpamilihanpagkagustonasasabihankonsultasyontiniradorkinabubuhaymagagandanghubad-barojobsmeriendabibisitacultivarmahirapkamalianhitsuralangpinamalagiartistasponsorships,duwendekumarimotpaglalabanapalitangbahaybrancher,kumalmanagsuotpamilyanami-missdaramdaminbeautybyggetnanunuksomakawalapagsagotdyipniasignaturainuulcernaglulutoprimeroslalargamakakamatutulogmatutongkailanmansalaminisinusuotginawanguniversitybulalastumamakesohulihanmagagamitnakakaanimpatakbonagbabalabanlaghinampasnuevomagdilimresearch,tagalgatolcurtainsgawingguidanceatensyonnocheangeladiaperligaligperwisyoentertainmentadmirednoongkasalananplagasanagardenlunesbookspelikulatulangbasahinboholmalumbaybusypadabogmalambingknightmeansjosetaingakayreplacedaniyabotantegoodeveningbinulongasthmatools,seekipagbilirhythmleyteawapinatidconnecting1980nagtalagakaagawintroducerichkumaripaspetsaamongdevelopedreducedouecomemapakalidahonilansumalicondostevedinalabeginningconnectionswimmingmakiling