Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

42 sentences found for "significant"

1. A father's love and affection can have a significant impact on a child's emotional development and well-being.

2. A lot of money was donated to the charity, making a significant impact.

3. Advances in medicine have also had a significant impact on society

4. Allen Iverson was a dynamic and fearless point guard who had a significant impact on the game.

5. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

6. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

7. Climate change is one of the most significant environmental challenges facing the world today.

8. Einstein also made significant contributions to the development of quantum mechanics, statistical mechanics, and cosmology.

9. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

10. Hashtags play a significant role on Instagram, allowing users to discover content related to specific topics or trends.

11. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

12. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

13. Hospitalization can have a significant impact on a patient's mental health, and emotional support may be needed during and after hospitalization.

14. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

15. Human activities, such as pollution and deforestation, have a significant impact on the environment.

16. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

17. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

18. Musk has donated significant amounts of money to charitable causes, including renewable energy research and education.

19. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

20. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

21. Nationalism has played a significant role in many historical events, including the two World Wars.

22. One of the most significant areas of technological advancement in recent years has been in the field of communications

23. One of the most significant impacts of television has been on the way that people consume media

24. Overall, money plays a central role in modern society and can have significant impacts on people's lives and the economy as a whole.

25. Overall, television has had a significant impact on society

26. Quiero hacer una contribución significativa a la ciencia a través de mi investigación. (I want to make a significant contribution to science through my research.)

27. She donated a significant amount to a charitable organization for cancer research.

28. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

29. Technology has also had a significant impact on the way we work

30. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

31. The Cybertruck, an upcoming electric pickup truck by Tesla, has garnered significant attention for its futuristic design and capabilities.

32. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

33. The king's reign may be remembered for significant events or accomplishments, such as building projects, military victories, or cultural achievements.

34. The king's role is often ceremonial, but he may also have significant political power in some countries.

35. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

36. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

37. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

38. With the advent of television, however, companies were able to reach a much larger audience, and this led to a significant increase in advertising spending

39. Wives can also play a significant role in raising children and managing household affairs.

40. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

41. Women have made significant strides in breaking through glass ceilings in various industries and professions.

42. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

Random Sentences

1. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

2. Wag kang mag-alala.

3. A couple of books on the shelf caught my eye.

4. Omelettes are a popular choice for those following a low-carb or high-protein diet.

5. La música puede ser utilizada para transmitir emociones y mensajes.

6. She has been knitting a sweater for her son.

7. Hindi ka sanay sa matinding init? Kung gayon, manatili ka sa lilim o sa malamig na lugar.

8. Sa takip-silim, maaaring mas mapakalma ang mga tao dahil sa kulay at hangin na mas malumanay.

9. Isa daw siyang mabangis na hayop dahil tulad nila meron din siyang matatalim na mga pangil.

10. Ang tindera ay nagsusulat ng mga listahan ng mga produkto na dapat bilhin ng mga customer.

11. Nanalo si Lito sa pagka gobernador ng kanilang lugar.

12. Nagpatawag ng pagpupulong ang guro sa silid-aralan upang pag-usapan ang mga plano para sa darating na taon.

13. Sa kanyang kaarawan, pinuno niya ang kanyang mesa ng mga masasarap na pagkain kaya't ito ay hitik sa mga putaheng lutong-buong.

14. Nakipagtagisan sya ng lakas sa mga kalaban.

15. The United States is the world's largest economy and a global economic superpower.

16. One example of an AI algorithm is a neural network, which is designed to mimic the structure of the human brain.

17. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

18. Pnilit niyang supilin ang hangaring makasilong.

19. He has been working on the computer for hours.

20. Nang umibig siya sa taga-lupang si Ramon, ang kanyang pagka-diwata'y tinalikdan niyang lubos upang mamuhay bilang ganap na tao.

21. Sa paglalakad sa gubat, minsan niya ring naisip na masarap maglakad nang nag-iisa.

22. She burned the dinner and then the smoke alarm went off. That just added insult to injury.

23.

24. Nakakatakot ang paniki sa gabi.

25. At tage ansvar for vores handlinger og beslutninger er en del af at have en god samvittighed.

26. Ano ang pangalan ng asawa ni Silay?

27. Naging malilimutin si Carla mula nang magkasakit siya.

28. Seperti makan buah simalakama.

29. Research and analysis are important factors to consider when making investment decisions.

30. Dahil dito ang mga tao ay laging may mga piging.

31. Hendes hår er som silke. (Her hair is like silk.)

32. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

33. The scientific study of astronomy has led to new insights into the origins and evolution of the universe.

34. Nagmadali akong pumasok sa kalsada nang abutin ko ang dakong huli ng bus.

35. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

36. Walang ka kwenta-kwenta ang palabas sa telebisyon.

37. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

38. Good afternoon po. bati ko sa Mommy ni Maico.

39. Paano magluto ng adobo si Tinay?

40. Hindi ko mapigilan ang puso ko na tumibok kapag nakikita kita. Crush kita talaga.

41. Einstein was awarded the Nobel Prize in Physics in 1921 for his discovery of the law of the photoelectric effect.

42. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

43. Hindi ko pa nababasa ang email mo.

44. Hindi kaya... kinumutan nya ako? Ah, malabo malabo.

45. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

46. She spilled the beans about the surprise party and ruined the whole thing.

47. Musk was born in South Africa and later became a citizen of the United States and Canada.

48. Talaga? Ano ang ginawa mo sa Boracay?

49. The seminar might be free, but there's no such thing as a free lunch - they'll probably try to sell you something at the end.

50. Los árboles pueden perder sus hojas en invierno, creando un aspecto desnudo y frío.

Recent Searches

ipinasignificantkaymagpapaikotpag-iinatnagpanggapvotessakupinpoolmaiingayseniorhablabakahaponkasangkapankumanannapapalibutanpupuntahannaibibigaymelissawikapangkattinuturodiinginoongexigentekubyertosmissionpakaininvivaopoaralblusanginiinomoscarisubohimutoknahihilosoonmagsabibilisvasquespaghahabikulisapmorenatwitchsystemhumblenasaanmagalangutilizarpanaylendingmamataantirangdisyemprelumindolmagkaparehomanagermananahinanunuksopapasanagdadasalhumansromerokalakihaninalalayanatagilirannakasandigwalangobserverernagsimulanawalangjuanitotumutubomansanasipaliwanagfithalagasumabogpapasokspecificgrowpalapaghugislenguajebroadcastsmakikipaglarokagandahanpinamalaginagpipilitmasakitnaiilangunti-untingnailigtaspotaenamahigitkagustuhangaaisshmagagandangkenjibinatangsalatinkriskaipinadalaspeedmatarayadventcrossuniquegoodnutrientesbahaywantbasketbolnabigyanusuarionanahimikgawinmongbabaengburmatherapypinyahumahagokendhatingthroattransmitidasmagkakagustoscientistsupilinnagtatanimmakitanakahigangaroundmagkasintahanlalakingrightshimignakakainmagkahawakkilalanakakarinigmagtakapandalawahanmismoiconicAlitaptapmayabongstrengthsumigawpangitinaapiuposincesarilimarielmalapalasyona-curiouspasaherolagingthanksgivingmangingisdangpartnerpagngitinakikitangsariwakatipunantagaytayaniyapresidentenagtitindapagkabuhaymapahamaknatinagpangangatawankamalayannakatayoraisegutomjustinkasingalas-dosriyannasagutanharapanninabutikihayaangpinangalanangbangkomasarapnagpakunotmabutiganunnapapatungofotostinatawagomfattendekainitan