Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "behalf"

1. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

2. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

3. The United States is a representative democracy, where citizens elect representatives to make decisions on their behalf

Random Sentences

1. Nang malaman ko ang kasinungalingan ng aking kaibigan, nagpalabas ako ng malalim na himutok sa aking sarili.

2. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

3. Nous avons fait un discours lors de notre réception de mariage.

4. Il est important de se fixer des échéances et de travailler régulièrement pour atteindre ses objectifs.

5. Bilang paglilinaw, ang sinabi kong oras ng meeting ay alas-dos ng hapon, hindi alas-tres.

6. Hindi ko maintindihan kung bakit niya nangahas na kunin ang bagay na hindi sa kanya.

7. Gusto kong bumili ng bestida.

8. They have planted a vegetable garden.

9. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

10. Araw araw niyang dinadasal ito.

11. She was named as one of Time magazine's most influential people in the world in 2016 and 2019.

12. Nakatingala siya kay Ogor, mahigpit na kinukuyom ang mga palad.

13. Nanghahapdi at waring nasusunog ang kanyang balat.

14. Hindi ko ho makain dahil napakaalat.

15.

16. Nang buksan ng mga tao ang ilang bunga ng punong-kahoy, kanilang nakitang ang balat ay makapal at ang buto ay malaki, ngunit ang laman nama'y matamis

17. Women make up roughly half of the world's population.

18. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

19. Tila hindi siya sang-ayon sa naging desisyon ng grupo.

20. Bakit kayo nagtungo sa Mendiola?

21. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

22. The United States has a system of representative democracy, where citizens elect representatives to make decisions on their behalf

23. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

24. Eine Inflation kann die wirtschaftliche Ungleichheit verschärfen, da Menschen mit niedrigerem Einkommen möglicherweise nicht in der Lage sind, mit den steigenden Preisen Schritt zu halten.

25. Nakarating na kami sa aming pupuntahan.

26. Mula sa malayo, anong gulat nila Magda nang makitang nagtalunan sa ilog sina Maria at Jose upang humabol.

27. Cancer research and innovation have led to advances in treatment and early detection.

28. Dumating na ang araw ng pasukan.

29. Aerob træning, såsom løb og cykling, kan forbedre kredsløbets sundhed og øge udholdenheden.

30. Libre si Clara sa Sabado ng hapon.

31. Kanino mo pinaluto ang adobo?

32. The telephone has undergone many changes and improvements since its invention, and it continues to evolve with the rise of mobile phones

33. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

34. Ang panaghoy ng mga pasyente ay naging panawagan para sa mas maayos na serbisyong pangkalusugan.

35. Cheating is the act of being unfaithful to a partner by engaging in romantic or sexual activities with someone else.

36. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

37. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

38. Hindi mo matitiis ang mga maarteng tao dahil sobrang pihikan sila.

39. Ano ang ilalagay ko sa kusina?

40. Puwede magdala ng radyo ang kaibigan ko.

41. Paano ako pupunta sa airport?

42. La serpiente de coral es conocida por sus llamativos colores y patrones, pero también es altamente venenosa.

43. Dapat mong namnamin ang tagumpay na iyong pinaghirapan.

44. Mayroon akong mga alinlangan sa kanilang plano kaya ako ay tumututol dito.

45. Bago ka lumusong, siguraduhin mong hindi ka malalunod.

46. Mahalagang ipaglaban natin ang ating kalayaan sa pamamagitan ng tamang pamamaraan.

47. Hindi ako sang-ayon sa mga komento na narinig ko tungkol sa iyo.

48. The diverse neighborhoods of Los Angeles, such as Chinatown, Little Tokyo, and Koreatown, offer unique cultural experiences and culinary delights.

49. Another example is a decision tree algorithm, which is used to make decisions based on a series of if-then statements.

50. "Dogs are better than human beings because they know but do not tell."

Recent Searches

behalfoverviewgayunpamanano-anolumitawkasinggandareaksiyonnatutuwakaniyanauliniganmasaholkaarawanhinihintaynaiilaganpalariyanlatersabihinnagtatakboalas-dosprocesosharenanalonyanapakabaitpresence,bumigayabrilmalimutanglobaltumubopasadyaitaksalitangbinigyangoffentligexhaustionpacienciahasupangfistskatedralpakukuluanmakuhangpagka-maktolnalulungkotadvertising,magpa-checkupdistansyamakalaglag-pantypagkakatayosakopnginingisiexigentemaskinermakakasumalakaypinapakinggansukatinkarapatangguerrerobumalikdikyammagigitingvetovivadeletingsilyamissionpamanmayamangnaiyaknakangisikapamilyakonsultasyonhumahangosiyanmagbayadnauponagsunurankaliwapinakabatangpaghuhugasnakalagaypinapakiramdamanmerlindanagmungkahianibersaryonakatunghaynagmasid-masidmabangodaddymahinamakaraantangekspinapalomasaksihankahariannagtaposmabagaltinuturokakutisvaccinesdiinnakatitigkaramihankurakotbalinganrelievedhoteltugonsuwaillunesatensyonsurroundingsrememberedilagaydisenyonatitiraganunlilipadsumasaliwsahigtmicahihigitde-lataphysicalgivemaisespigasmahahabawalalinggoparkingargueilawairconmaaliwalasmakapangyarihangselllegendsasulcollectionssinapakconsistpierramdamresignationflexiblegandarestawanpasyaleukemiatanimperlalumakiochandonilalangbabanagtitindaprotestaconnectionsutiltipidspaghettileecompartenangganidnabigaytubig-ulansaan-saanhatebiglaanbilingdoingtechnologicalumarawcomunicarseservicesreallyonlystatinghawaknagpakitalumuwastrentatrueincredibleanotherpagkabatapagkaawakasabayjobsginangdistanciasellinglatewaterinit