Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "history"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. He applied for a credit card to build his credit history.

7. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

8. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

9. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

10. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

11. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

12. In conclusion, the telephone is one of the most important inventions in human history

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

15. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

16. Kings have held power throughout human history, from ancient civilizations to modern times.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Mathematics has a long history and has contributed to many important discoveries and inventions.

19. Nationalism often emphasizes the importance of a common language, culture, and history.

20. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

21. She has a poor credit history due to late payments and defaults on loans.

22. She watched a series of documentaries about the history of ancient civilizations.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Television has a rich history, and its impact on society is far-reaching and complex

25. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

26. The Great Wall of China is an impressive wonder of engineering and history.

27. The Lakers have a rich history and are one of the most successful franchises in NBA history.

28. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

29. The patient had a history of pneumonia and needed to be monitored closely.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

34. The website has a lot of useful information for people interested in learning about history.

35. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

36. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Ailments can have physical symptoms, such as pain, fatigue, or fever, as well as psychological symptoms, such as anxiety or depression.

2. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

3. Mababaw ang swimming pool sa hotel.

4. My daughter is in her school play tonight - I told her to break a leg.

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Holy Week påskeugen er den vigtigste religiøse begivenhed i den kristne tro.

7. Palibhasa ay marunong magpakumbaba kahit na mas matalino siya kaysa sa iba.

8. Sinabi ng guro na huwag magtapon ng basura palayo sa tamang basurahan.

9. Nakilala ko ang taong pinapangarap ko kaya masayang-masaya ako ngayon.

10. Puwede ho ba akong pumasok sa klase?

11. Les mathématiques sont une discipline essentielle pour la science.

12. Tulad ng dati ay araw araw siyang sumusulat kay Helena ngunit bihira ng sumagot ang dalaga sa mga sulat niya.

13. Hindi ko maintindihan kung ano ang nangyari kaya ako ay tulala sa kawalan.

14. Thanks you for your tiny spark

15. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

16. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

17. Sa pangalan ni Apolinario Mabini binuo ang isang award ng Department of Social Welfare and Development para sa mga organisasyong may malaking kontribusyon sa pagtugon sa mga pangangailangan ng mga mahihirap sa lipunan.

18. Bilang diwata ay wala siyang kapangyarihang magdugtong ng buhay, datapuwa ang magbigay ng panibagong buhay sa bagong anyo ay kanyang magagawa.

19. Les personnes motivées ont tendance à être plus productives et à atteindre leurs objectifs plus rapidement.

20. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

21. Ang kasal ay isa sa pinakamahalagang okasyon sa buhay ng isang tao.

22. Hindi umimik si Lory sa mga tanong ni Chad.

23. Anong oras mo gustong umalis ng bahay?

24. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

25. Siya ang pinuno ng rebolusyonaryong kilusan laban sa pananakop ng mga Espanyol.

26. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

27. Su estilo artístico se caracterizaba por la tensión emocional y la expresión dramática.

28. Nakatayo ito sa harap ng isang bilao ng kangkong at sa malas niya ay tumatawad.

29. Les maladies transmissibles peuvent se propager rapidement et nécessitent une surveillance constante.

30. Robusta beans are cheaper and have a more bitter taste.

31. En Nochevieja, nos reunimos con amigos para celebrar el Año Nuevo.

32. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

33. I always feel grateful for another year of life on my birthday.

34. Kailan po kayo may oras para sa sarili?

35. Pumupunta ako sa Laguna tuwing Mayo.

36. Ang mais ay tumutubo nang mabuti sa lugar na may malaking access sa araw at sapat na kahalumigmigan

37. Nilalakad namin ang mapa para mahanap ang aming pupuntahan.

38. Mommy. ani Maico habang humihingal pa.

39. Me duele al tragar. (It hurts when I swallow.)

40. Les hôpitaux sont équipés pour fournir des soins d'urgence aux patients.

41. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

42. Nagagandahan ako kay Anna.

43. Close kasi kayo ni Lory. ngumiti sya na sobrang saya.

44. Ibinigay ni Aling Marta ang kanyang pangalan at tinitirhan at pagkatapos ay tuwid ang tinging lumayo sa karamihan.

45. Bukas ang kupasing damit na giris, nakahantad ang laylay at tuyot na dibdib.

46. Las redes sociales son una plataforma para compartir fotos y videos.

47. Hun er en af ​​de smukkeste kvinder, jeg nogensinde har set. (She is one of the most beautiful women I have ever seen.)

48. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

49. Accepting the job offer without reading the contract was a risky decision.

50. Bukas ay pumunta daw po kayo sa school sabi ng aking teacher.

Recent Searches

historylumindolpandidiripracticadocontrolledprivatebinawianmagdamaganuwakkarapatansocialessoccernapalitanglegislationbingiyeykommunikerernearkatipunannatinagnakakatandabahagyatinanggapmangyarisabadongcongresstahimikalagacongratspaglalabadaeducationbateryalinggo-linggolabinsiyamdespuesngumingisiaywanbiocombustiblesmovingnagkakasyaumalislimoskahilingannag-aabangplatformkerbnapakalusogtoretemartiansuotbagyonglunetanaiwannakikini-kinitamalayangpinapataposnagpatulonglivesinvestmagpapabunotsportshigupinpag-aapuhapdangerouspaksanasisiyahanpinagkiskissigawnakatapattradeumuporollclienteshigaherramientayourmawalapanigjobsmalamignaawanaroon10thenviardraft,inhalegumawaimportantkataganuevostsssnaabutanmahiwagangitopaldatsaatulangmagpakaraminakakatawanangyaripagkabiglakitanggodpaki-drawingganapayongmaputisantospinagkasundoechavewatchingneedsdulotpersonalmagpalagobinataklayout,motionmasayang-masayakasalnicoabundantetopiclondonnagmamadalisumasakitnakakaanimbitiwanmagpaliwanagpagepapuntangdispositivokamustabairdkaharianmag-asawangpoorersusunduinespadakwebangnagdiretsoactionpagbahingnakagalawofteipinatawaggabi-gabinakabawiuniversetnagpapaigibnatitiyakbinibiniiiwasanpalabuy-laboymagtagopasasalamatfuncionesmakikipaglaroulingmonetizingpowersniyalalargapetsamagbagong-anyoredbulalasanakalaunanroofstockkadalagahangkomunikasyonkendijenabilinpeoplebernardofremtidigemagpapigilkalalaronagpalalimmakebagrecentlypshpagkaingbusinessesmabilishapasinnagbabalasinoculturasnagbungaseriouskidkirankaymatapobrengilalagaynalalabingpaanong