Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "history"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. He applied for a credit card to build his credit history.

7. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

8. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

9. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

10. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

11. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

12. In conclusion, the telephone is one of the most important inventions in human history

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

15. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

16. Kings have held power throughout human history, from ancient civilizations to modern times.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Mathematics has a long history and has contributed to many important discoveries and inventions.

19. Nationalism often emphasizes the importance of a common language, culture, and history.

20. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

21. She has a poor credit history due to late payments and defaults on loans.

22. She watched a series of documentaries about the history of ancient civilizations.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Television has a rich history, and its impact on society is far-reaching and complex

25. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

26. The Great Wall of China is an impressive wonder of engineering and history.

27. The Lakers have a rich history and are one of the most successful franchises in NBA history.

28. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

29. The patient had a history of pneumonia and needed to be monitored closely.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

34. The website has a lot of useful information for people interested in learning about history.

35. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

36. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Hindi lang nila naririnig kundi nakikita pa ang katuwaan ng lahat.

2. Forgiving ourselves is equally important; we all make mistakes, and self-forgiveness is a vital step towards personal growth and self-acceptance.

3. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

4. Tumakbo siya para sa pagka-pangulo noong 1935 ngunit natalo kay Manuel Quezon.

5. The bookshelf was filled with hefty tomes on a wide range of subjects.

6. Huwag magpabaya sa pag-save at pag-invest ng pera para sa kinabukasan.

7. Kaya lumaki si Pinang sa layaw.

8. Sa kalikasan, mahalaga ang mga punong-kahoy dahil ito ang nagpapakain sa iba't ibang uri ng hayop at insekto.

9. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

10. Nationalism can be both a positive force for unity and a negative force for division and conflict.

11. No tengo apetito. (I have no appetite.)

12. Ang buhay ko ay hindi na magtatagal, habang ako ay may kapangyarihan pa, binibiyayaan ko kayo ng iyong asawa ng isang anak..

13. Hindi rin dapat supilin ang kalayaan ng mga mamamayan na magpahayag ng kanilang opinyon.

14. Nagdulot umano ng matinding trapiko ang biglaang pagkasira ng tulay.

15. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

16. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

17. El acceso al agua potable es un derecho humano fundamental.

18. Bagaimanakah kabarmu hari ini? (How are you today?)

19. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

20. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

21. Oh sige na nga sabi mo eh. hehe.

22. La obra social produjo una gran ayuda para los más necesitados.

23.

24. Handa ko pong gawin ang lahat para lang tuparin Mo po ang aking kahilingan.

25. Hindi pangkaraniwang araw ito at kinakailangang magkaroon silang mag-anak ng hindi pangkaraniwang pananghalian.

26. Mga prutas ang tinitinda ng tindera.

27. Nagsisikain ang mga bata ng tinapay.

28. Ang pangamba ay maaaring maging dahilan ng hindi pagpapakatotoo sa ating mga pangarap.

29. A king is a male monarch who rules a kingdom or a sovereign state.

30. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

31. Umalis siya papuntang Cebu kahapon ng hapon.

32. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

33. Elektronisk udstyr kan hjælpe med at forbedre effektiviteten og produktiviteten af ​​virksomheder.

34. La fábrica produjo miles de unidades del producto en solo un mes.

35. Si Andres Bonifacio ay isang magiting na bayani.

36. Exercise can be tough, but remember: no pain, no gain.

37. Halos anim na oras silang naglakad paakyat ng bundok makiling.

38.

39. Nag-iingat siya na hindi humalinghing nang malakas dahil baka mahalata ng kanyang kalaban.

40. Es importante cosechar las zanahorias antes de que se pongan demasiado grandes.

41. Mapapa sana-all ka na lang.

42. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

43. Embroidery scissors have pointed tips and small blades for intricate cutting in sewing and embroidery work.

44. La película produjo una gran taquilla gracias a su reparto estelar.

45. Umiinom si Andy ng vitamins kaya ang katawan nito ay bihirang magkasakit.

46. Sinubukan kong magpakilig sa aking nililigawan sa pamamagitan ng pagkanta ng isang love song.

47. Initial coin offerings (ICOs) are a means of raising capital through cryptocurrency crowdfunding.

48. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

49. Aling bisikleta ang gusto mo?

50. Hindi ko matiis ang mga taong laging mangiyak-ngiyak.

Recent Searches

historyadasagingcomplexkara-karakanagkwentonakakagalamaglalaropinaghatidanpioneermiraminu-minutoparusahanoperativosbahagyainlovearabiasurroundingsiguhitkategori,nakaka-innanghihinamadtinatanongmakausapricokasakitasahanpanataggagawakinauupuangbeenpaga-alalanakatinginpicturetaolumayopaglulutoairportpamasaheboholbagkusmeaninghitikaabothversamakatwidnakakatulongipagpalitopisinanagsilapitpinipilittennisspecializedvotestandaadvancedtiyakpalamutisinipangthennatingaladawkapilinggapprocesoitukodmalaslilipadcomunicanpinagmasdanstylesthinglimitbantulotmasayang-masayanghabitsipinadakipcombinedcoaching:nasirafilipinalovemaximizingnagsinepag-akyatnai-dialsumasayawtumawagnaririnigmalapitauditsasabihindownmagdoorbelltotoongsonidomalikotbagyonauntogkapiranggotmagsuotsulyapnanlilimahidrecordedmusmospagkatakotpamanhikanmaraminagulatkausapinkauntisuffernasunogpangkatbagamattinalikdanpaladpotentialgabi-gabirestlabananrawamingkundistyrerskytelephoneleadersnabighanidiretsopuntahandagatkonsultasyonskills,tiniklingnaramdamanbinitiwanpare-parehohumalakhakpagkakatayodisenyongmagnakawpinakabatangnakatirangunitnapakaselosokumainnaglulusakdeletingrestawranvariouscalidadasiakaawaykayongbangkangnaiiritangsarongnatakotnapakamotwaysbranchmabilisrobinhoodmangingisdangstartedclassesdatayeahpumulotpagsusulatlumipaspasahelibrepracticadopamamasyalparkepagkakalapatfertilizermahuhulibabaeroexhaustedpagka-datupagdamixviiaraylibonglugawkinagalitanmaghahatidhumayomarangalmaynilaenergiearnheifredkomedorpusabawa