Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "history"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. He applied for a credit card to build his credit history.

7. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

8. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

9. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

10. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

11. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

12. In conclusion, the telephone is one of the most important inventions in human history

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

15. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

16. Kings have held power throughout human history, from ancient civilizations to modern times.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Mathematics has a long history and has contributed to many important discoveries and inventions.

19. Nationalism often emphasizes the importance of a common language, culture, and history.

20. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

21. She has a poor credit history due to late payments and defaults on loans.

22. She watched a series of documentaries about the history of ancient civilizations.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Television has a rich history, and its impact on society is far-reaching and complex

25. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

26. The Great Wall of China is an impressive wonder of engineering and history.

27. The Lakers have a rich history and are one of the most successful franchises in NBA history.

28. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

29. The patient had a history of pneumonia and needed to be monitored closely.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

34. The website has a lot of useful information for people interested in learning about history.

35. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

36. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Investing in stocks or cryptocurrency: You can invest in stocks or cryptocurrency through online platforms like Robinhood or Coinbase

2. Quiero contribuir a la protección del medio ambiente y hacer del mundo un lugar mejor para vivir. (I want to contribute to the protection of the environment and make the world a better place to live.)

3. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

4. Siya ay kilala sa kanyang abilidad sa pagsusulat ng mga makabuluhang tula.

5. In recent years, television technology has continued to evolve and improve

6. Kumaliwa ka sa susunod na kanto.

7. Saan ka kumuha ng pinamili mo niyan?

8. Walang kagatol gatol na sinagot ni Juan ang tanong ng kanyang teacher.

9. Ada asap, pasti ada api.

10. Sumakay pa rin sila ng bangka at umalis kasabay ng agos ng ilog.

11. Has she written the report yet?

12. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

13. Ako ngayo'y lumilipad at nasa langit na.

14. La conciencia es la voz interior que nos guía hacia lo correcto y lo incorrecto.

15. We have a lot of work to do before the deadline.

16. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

17. Iginitgit din niya ang sa kanya, bahagya nga lamang at takot na paggitgit.

18. Ang mga sumusunod na salita ang nagsasabing siya ay pulubi.

19. Ano ang mga ginawa niya sa isla?

20. Pang-isahang kuwarto ang gusto niya.

21. Sa pag-alis niya sa tahanan, nag-iwan siya ng mga alaala at mga kuwentong puno ng pagmamahal.

22. May ipinadala pong pakete sa akin ang ate ko.

23. Palibhasa hindi niya kasi malaman kung mahahanay ba siya na isang mabangis na hayop o di kaya'y ibon.

24. Ang mga dragon at lion dance ay karaniwang makikita sa mga kalye tuwing Chinese New Year.

25. Drømme og håb kan drive os fremad i livet.

26. A microscope is a device that uses lenses to magnify small objects.

27. Ngunit kahit ganyan ang kinalalagyan.

28. The Colosseum in Rome is a remarkable wonder of ancient Roman architecture.

29. Wag kang magtatanim ng sama ng loob sa kapwa.

30. Si Ogor, Impen, pahabol na bilin ng kanyang ina.

31. Sino ang kasamang kumanta ni Katie?

32. Bukas na lang kita mamahalin.

33. I know things are difficult right now, but hang in there - it will get better.

34. Women have been leaders in social justice movements, such as the civil rights movement and the women's suffrage movement.

35. Musk has expressed a desire to colonize Mars and has made significant investments in space exploration.

36. Mas malaki ang silid-aralan ngayon kumpara sa dati dahil sa pagdami ng mga estudyante sa paaralan.

37. Tila wala siyang naririnig.

38. Ang mabuting anak, nagpapalakas ng magulang.

39. La realidad es que a veces no podemos controlar lo que sucede.

40. Mahalaga ang pag-aaral ng talambuhay ni Marcelo H. del Pilar upang maunawaan ang kanyang papel sa kasaysayan ng Pilipinas.

41. Ang poot ay maaaring maging mapaminsalang puwersa kapag hindi ito naayos nang maayos.

42. Mahalaga ang maagap na pagtugon sa pangamba upang maiwasan ang mas malaking panganib.

43. Gumamit ang albularyo ng dahon ng bayabas upang linisin ang sugat ni Pedro.

44. All these years, I have been learning and growing as a person.

45. Naiinggit ako sa ibang hayop at halaman na tuwang-tuwa kapag may handaan sa kagubatan.

46. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

47. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

48. Las escuelas son responsables de la educación y el bienestar de los estudiantes.

49.

50. Dahil sa kanyang pagka-suway, si Carla ay napag-initan ng kapwa niya empleyado.

Recent Searches

tennismauupohistorykahongtumikimpoonginilistamagdaraosnakahugmakauwikolehiyoeconomicthanksnangingilidsikathawlanaglabaparaangmassachusettskaunticynthiapagiisipnaghubadmadadalagigisingminamasdanhinintaytagakbuwayanandiyandiliginsisentarecibirinfusionesmamarilseasitecellphonenetflixbritishexpresaneneroewannaissandaliiigiblasaeffort,nizo-orderpanabighaniestasyonmagigitingparkinglasonowndrogapaalamnaiinggitbingbingbumabahakaraokepasalamatanmagisingnicodagligedalagangpasigawmalamanghopebumabagsandoktotooattentiontoladangpagkakahiwatoretemakaratinggrammarmorenatinitirhaninomhiningimaskidapit-haponeasyvampiresbiensiyabroadcastsystematiskbalingyeloreboundfurilognoocanadavigtigumanoipinambilikasinaniniwalawebsiteteachdontpakpakjustcoatdatideathmaihaharap10thouebillchadpicsdagatpagkalapitpagkainnagmakalapitpaitleoleeganotherdedicationusingcirclehulingguiltykitexperts,niceactiontanawinfullhatingpeteryousay,bodegamagselosvocalagilitysinisitradisyonipongnumbernapatungoprovidedmakasahodpatungoawang-awamiyerkolesvaliosamateryalesestablishdiretsolayout,studentfuncionarlorenahomeworktransitneromabutinglaylaygamesfonomakaintahananleetinaasdesdemakawalainspirasyonharipaghusayanlatekemi,t-shirtnagtungoumamponovertumalonnagsulputankumalatdialledeskwelahanbawatpakaininluluwasmagbalikdarksabongdesisyonannangyarinakahigang