Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "history"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. He applied for a credit card to build his credit history.

7. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

8. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

9. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

10. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

11. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

12. In conclusion, the telephone is one of the most important inventions in human history

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

15. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

16. Kings have held power throughout human history, from ancient civilizations to modern times.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Mathematics has a long history and has contributed to many important discoveries and inventions.

19. Nationalism often emphasizes the importance of a common language, culture, and history.

20. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

21. She has a poor credit history due to late payments and defaults on loans.

22. She watched a series of documentaries about the history of ancient civilizations.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Television has a rich history, and its impact on society is far-reaching and complex

25. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

26. The Great Wall of China is an impressive wonder of engineering and history.

27. The Lakers have a rich history and are one of the most successful franchises in NBA history.

28. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

29. The patient had a history of pneumonia and needed to be monitored closely.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

34. The website has a lot of useful information for people interested in learning about history.

35. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

36. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. Les personnes âgées peuvent avoir des problèmes de sommeil en raison de la douleur et de l'inconfort.

2. Noong kabuntisan ng kanyang ina sa kapatid niyang bunso ay iniwan ito ng asawa.

3. Don't waste your money on that souvenir, they're a dime a dozen in the market.

4. He thought it was a big problem, but in reality it was just a storm in a teacup.

5. Halos magkasing-edad sila ni Bereti kaya madaling nagkalapit ang mga loob.

6. Inaalam pa ng mga imbestigador ang tunay na motibo ng salarin sa krimeng nagawa niya.

7. Les programmes d'études sont élaborés pour fournir une éducation complète.

8. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

9. The patient was instructed to take their blood pressure medication as prescribed to control high blood pressure.

10. Palibhasa ay mahilig mag-aral at magpahusay sa kanyang mga kakayahan.

11. Ang mabuting kaibigan, ay higit pa sa kayamanan.

12. Matagal din bago napawi ang paninigas ng kanyang pigi.

13. Las plantas son seres vivos que realizan la fotosíntesis para obtener energía.

14. Dancing all night at the club left me feeling euphoric and full of energy.

15. Menos kinse na para alas-dos.

16. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

17. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

18. Napahinto rin kami dahil kay Jenny.

19. Kailan ka libre para sa pulong?

20. Pero kahit marami ang sumunod sa itinuturo ng paring Espanyol ay may isang barangay na bulag pa ring sumasamba sa mga anito.

21. Oo na. Umuwi ka na. Di ko na ipapaputol ang card mo.

22. Mahalaga rin ang pagkakaroon ng kooperasyon at pagtutulungan upang malutas ang mga palaisipan sa isang grupo o komunidad.

23. Sa aming mga paglalakbay, nakakita kami ng mga kapatagan na mayabong na mga pastulan.

24. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kita ligawan?

25. La música puede ser utilizada para fines políticos o sociales.

26. Sino sa mga kaibigan mo ang matulungin?

27. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

28. Nasa Diyos ang awa, nasa tao ang gawa.

29. Lumingon ako sa kanya. Kita ang paga-alala sa mga mata niya.

30. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

31. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

32. Ngayon lang ako nag mahal ng ganito.

33. Pinahiram ko ang aking gamit pang-camping sa mga kaibigan ko para sa aming weekend getaway.

34. Hindi lahat ng ating mga pangarap ay madaling makamit, kaya't kailangan nating magpakatatag.

35. Tulad ng sinabi nito, ang ulan ay hindi na huminto pa.

36. The acquired assets will be a valuable addition to the company's portfolio.

37. Ano ang kulay ng notebook mo?

38. S-sorry. nasabi ko maya-maya.

39. Sa pagsasaayos ng paaralan, ang bayanihan ng mga guro at magulang ay nagdulot ng magandang resulta.

40. Bumabaha sa amin tuwing tag-ulan.

41. May kahilingan ka ba?

42. Eksport af forskning og udvikling er en vigtig del af den danske økonomi.

43. Hinugot niya ang susi sa kanyang bulsa at binuksan ang pinto.

44. The United States is a culturally diverse country, with a mix of ethnicities, languages, and religions.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Hawak ang tirador ay sinaliksik ni Kiko ang buong paligid.

47. Tantangan hidup memberikan kesempatan untuk memperluas kemampuan dan meningkatkan kepercayaan diri.

48. Si tienes paciencia, las cosas buenas llegarán.

49. Napakahalaga ng pag-unlad ng mga pagsasaliksik sa talambuhay ni Apolinario dela Cruz bilang isang relihiyosong lider.

50. Ang pagkakaroon ng mga programa at kampanya sa paglaban sa droga ay mahalaga upang maiwasan ang pagkalat nito sa lipunan.

Recent Searches

mauupohistorynatabunanuusapancosechar,mbricosmaynilainilabasngitiganapinnatinagipinauutangmasaholkastilasisentabinawianmalasutlaahhhhpaliparinnaghubadsakenunangkuwebastarredcreatesagotscientificolawaynandiyanrepublicanlasakumustahinintaygownquarantinecalidadvariedadreplacedlapitanboracayinom1920scapitalcalciumnunoskypelandemayabangbumabahaiskedyulmarmaingmataposbumabagtambayanpebreromasdankatabingdalandanjoshsumabogbusiness,fueomglutonalulungkottablematandang-matandateachingspookipinabaliknathanunderholdermulconvertidasideaswidespreadmarsochadtumulongpinalakingeksampeterthoughtsneroadditionallynilutoreservedlangreporthinagud-hagodcallingedit:multomenucommercepuntacircleniceaggressiongoinginiinomdogssirsyncgitanaswriteprogrammingdoingevolvemediumkasingexplaindulogumagalaw-galawdamdaminkinasangkapmakapanglamangkarununganarmedstudentspag-aanihalamanestáhinamakhatinggabinagtutulunganpinabayaannaulinigansaritasabadokontinentengpaginiwangardenmag-inaphilippinemakapagpigilpaglipasnakasandigkamotehinding-hindimabatongnakatuonganidthanknagkalapitpunung-kahoysummermulighederlaylayrightpakibigaysolidifydecreasenagtatakbopotaenasundhedspleje,nakakitapinagsikapanmagkahawakpunong-kahoyclubnagpalalimkarwahengjobsmagpaniwalamakikipagbabagtravelerkikitamumuranakatayonananaginiphealthiernagre-reviewpinakamatabangreserbasyonpollutionnagsusulatkomunikasyonnakapagreklamotungawnaabutanpinag-aaralannalugmokgirlpumapaligidmakapagsabiminu-minutomaliksilungsodbilibidcruznaliligotig-bebeintenapuyatbumaligtadpagguhitamericaminatamis