Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "history"

1. Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

2. Coffee has a long history, with the first known coffee plantations dating back to the 15th century.

3. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

4. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

5. Hakeem Olajuwon was a dominant center and one of the best shot-blockers in NBA history.

6. He applied for a credit card to build his credit history.

7. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

8. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

9. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of martial arts

10. Hockey has a rich history and cultural significance, with many traditions and customs associated with the sport.

11. In conclusion, Bruce Lee was a martial artist, actor, and philosopher who is widely considered to be one of the most influential figures in the history of martial arts

12. In conclusion, the telephone is one of the most important inventions in human history

13. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

14. Kareem Abdul-Jabbar holds the record for the most points scored in NBA history.

15. Karl Malone, also known as "The Mailman," is considered one of the best power forwards in NBA history.

16. Kings have held power throughout human history, from ancient civilizations to modern times.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Mathematics has a long history and has contributed to many important discoveries and inventions.

19. Nationalism often emphasizes the importance of a common language, culture, and history.

20. Overall, coffee is a beloved beverage that has played an important role in many people's lives throughout history.

21. She has a poor credit history due to late payments and defaults on loans.

22. She watched a series of documentaries about the history of ancient civilizations.

23. Television has a long history, with the first television broadcasts dating back to the 1920s

24. Television has a rich history, and its impact on society is far-reaching and complex

25. The belief in God is widespread throughout human history and has been expressed in various religious traditions.

26. The Great Wall of China is an impressive wonder of engineering and history.

27. The Lakers have a rich history and are one of the most successful franchises in NBA history.

28. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

29. The patient had a history of pneumonia and needed to be monitored closely.

30. The patient's family history of high blood pressure increased his risk of developing the condition.

31. The patient's family history of leukemia increased their risk of developing the disease.

32. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

33. The United States has a rich history, including the founding of the country, the Civil War, and the Civil Rights Movement.

34. The website has a lot of useful information for people interested in learning about history.

35. These films helped to further cement Presley's status as a cultural icon and helped to solidify his place in the history of American entertainment

36. Throughout history, technology has played a vital role in shaping human civilization and has had a profound impact on society

37. Women have made significant contributions throughout history in various fields, including science, politics, and the arts.

Random Sentences

1. She collaborated with other TikTok creators to create a popular challenge that trended on the app.

2. Matapos masaksihan ang kababalaghang iyon ay saka pa lang nalaman ng mga kanayon ang pagiging diwata ni Tarcila.

3. Sweetness can be balanced with other flavors to create a harmonious taste experience.

4. Ariana is an advocate for animal rights and follows a vegan lifestyle.

5. The telephone quickly caught on, and by 1878, Bell's company, the Bell Telephone Company, had more than 50,000 subscribers

6. The phone rang late at night, and therefore she was hesitant to answer it.

7. Ayaw niya sanang ipaalam ito sa iyo dahil ayaw niyang mag-alala at maawa ka sa kanya.

8. Kapag mahangin, inililipad nito ang mga dahon palayo sa halamanan.

9. Mayroon akong asawa at dalawang anak.

10. Ang pagdidilim ng kalangitan ay nagpakalma sa init ng araw at nagbigay daan sa isang magandang sunset.

11. The relationship between work and mental health is complex and can vary from person to person.

12. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

13. Nagtatrabaho ako sa Mimosa Family Home.

14. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

15. Isang matandang lalaki naman ang tumikim sa bunga.

16. Mahina ang tulo ng tubig sa kanilang pook.

17. Ang aso ni Lito ay mataba.

18. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

19. Awang-awa ang maraming katutubo sa pagpapasan sa krus si Padre Novelles.

20. Isa sa kanyang kasamahan sa bilangguan ay si Tony

21. Sa kulturang Pilipino, ang punong-kahoy ay kinikilala bilang simbolo ng kalikasan at pagiging matatag.

22. Sino ang kasama niyang nagbakasyon?

23. Gusto niyang lumayo at maglakbay palayo sa lugar ng kanyang kabataan.

24. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

25. Nalungkot ang Buto nang dumilim na ang paligid.

26. Sa harap ng outpost ay huminto ang pulis.

27. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

28. Ailments can impact different populations disproportionately, such as people of color, women, and those with low socioeconomic status.

29. Bwisit ka sa buhay ko.

30. The symptoms of pneumonia include cough, fever, and shortness of breath.

31. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

32. Dahil sa tag-ulan, ang temperatura ng panahon ay kadalasang mas malamig at mas nakakapalamig.

33. Ang dami daw buwaya sa kongreso.

34. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

35. Galit din sumagot si Amparo "Anong gusto mo alilain ako at busabusin, ako ang masusunod dahil ako ang nakakatanda".

36. I am teaching English to my students.

37. Anong petsa na? salubong sa akin ni Aya.

38. Congress, is responsible for making laws

39. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

40. Maging si Amba ay natulala sa mahirap na disenyong nagawa ng matanda.

41. Pagtatanim at pagbebenta ng gulay ang kinabubuhay ng magasawang Waldo at Busyang na parehong masipag at mabait.

42. The flowers are not blooming yet.

43. She does not use her phone while driving.

44. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

45. Dime con quién andas y te diré quién eres.

46. Tumawa nang malakas si Ogor.

47. Nabigkas ni Tarcila ang mahiwagang kataga bago nalagutan ng hininga sina Lala, Dada at Sasa kaya sa isang kisapmata ang tatlong dalaga ay naging ISDA!

48. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

49. "Ang taong nagiging bato sa huli, dapat alisin ang sariling uka" ay isang bukambibig na nagpapahiwatig na ang mga taong nagiging matigas ang loob o nagbubulag-bulagan sa mga sitwasyon ay dapat magbago.

50. Ang paggamit ng droga ay madaling simulan, ngunit mahirap nang itigil.

Recent Searches

nakapagproposesasakaytrabahohistorynaiinisinlovekapataganlumagolungsodbinentahaneksempelnaiiritangisinaboytelecomunicacionespaskoupolegislationhusoaabotsipabeginningsagadhitikasopunsomagsaingcityumigibunosnakabiladhinagisdesign,paglayasrightslugawpagsidlanincredibleadainjuryanaasiamaghintaysayawanpagkaingpagdamiamendmentsreynaplanning,alagakamotepaggawanagisingpangkatnyansmileatensyonipinamilidespuesmachinesmatitigaspublicitysapotcarbonmagbigayandefinitivomagigitingkatagalankayabalatmaingatlistahansagapdyiphaytresexhaustedbumabagtignansarabalangpanindangsikoelectoralukol-kaypaidgamitnanaignagtatakangthreebackrequireablewindowtermlargeinteligentesayantechnologicalpuntahanmalapitanpagkakahawaktanimmabiliscommunityleyteipagbilisore1000kainremainibigcompostelafatminutefriespangulostarsparkbugtongdaysbiggestnaritoshowallowedgenerabaandyrawbringingcasespersistent,armedfullmagbubungalimitnakilalapakilagayacademymisakutodbayansumalakaylastinglibrepracticadofarledconnectionconectanplaysdidateeksenadevelopcomputerstringprogrammingneedswithoutbehaviorformsguidetiniopasyentenagsunurantumamisbumisitanasaanhumiwalaypostkommunikererdiyannagre-reviewlabananuwaknakakatandashapingjustpresidentehugisrestawranpaperbuwenashinabolmamayanearkinauupuangkakuwentuhannakakitanasasaktannasanwesternayusinmagbabayadyumabongpinapalomahuhusaysunud-sunuranimportungawnanlaki