Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "job"

1. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

2. Accepting the job offer without reading the contract was a risky decision.

3. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

4. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

5. Has he started his new job?

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

8. I prefer to arrive early to job interviews because the early bird gets the worm.

9. If you quit your job in anger, you might burn bridges with your employer and coworkers.

10. Many people experience stress or burnout from overworking or job dissatisfaction.

11. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

12. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

13. She has quit her job.

14. She has started a new job.

15. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

16. The job market and employment opportunities vary by industry and location.

17. The presentation was absolutely flawless; you did a great job.

18. The uncertainty of the job market has led to many people rethinking their career paths.

19. Working in a supportive and positive environment can improve job satisfaction.

20. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

Random Sentences

1. Omelettes are a popular choice for those following a low-carb or high-protein diet.

2. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

3. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

4. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

5. Bumuga na lang ng hangin si Maico saka tumingin kay Mica.

6. Si tienes paciencia, las cosas buenas llegarán.

7. Ang bayanihan ay nagpapakita ng diwa ng pagmamalasakit at pagbibigayan sa aming komunidad.

8. Hindi siya makatulog dahil sa kati ng bungang-araw.

9. Emphasis can help clarify and reinforce the meaning of a message.

10. He used his good credit score as leverage to negotiate a lower interest rate on his mortgage.

11. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

12. This can include creating a cover, designing the interior layout, and converting your manuscript into a digital format

13. Ibinigay niya ang kanyang pagmamahal at pag-aalaga upang masiguro ang kaginhawahan ng kanyang pamilya.

14. Tu peux me passer le sel, s'il te plaît?

15. Ha?! Ano ba namang tanong yan! Wala noh!

16. Payapang magpapaikot at iikot.

17. Dali-daling umalis ang binata patungo sa palasyo.

18. Motion kan udføres indendørs eller udendørs, afhængigt af ens præferencer og tilgængeligheden af ​​faciliteter.

19. Ano namang naiisip mo? tanong ko sa mapag-asang tono.

20. Electric cars have a lower center of gravity, which can improve handling and stability.

21.

22. Advances in medicine have also had a significant impact on society

23. Ang puting pusa ang nasa sala.

24. Natawa na lang ako sa magkapatid.

25. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

26. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

27. Ang pag-asa ay nagbibigay ng pagkakaisa sa mga tao sa kanilang pangarap at mga layunin sa buhay.

28. Ang talambuhay ni Emilio Jacinto ay nagpapakita ng kanyang kabataan at ang kanyang kontribusyon sa rebolusyon.

29. Sa kabila ng kanyang yaman, napaka-maramot niyang tumulong sa charity.

30. Hinawakan ko siya sa may balikat niya.

31. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

32. The authorities were determined to find the culprit responsible for the environmental damage.

33. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

34. Huwag kang mag-focus sa kababawan ng isang tao, tingnan mo ang kanyang kalooban.

35. Panahon ng pananakop ng mga Kastila

36. Nagitla ako nang biglang may lumabas na ahas mula sa mga halamanan.

37. No podemos negar la realidad, debemos aceptarla y adaptarnos a ella.

38. Este plato tiene un toque picante que lo hace especial.

39. Ang guro ang pinagpalaluan ng lahat ng kanyang mga estudyante dahil sa kanyang kabaitan.

40. The cutting of the wedding cake is a traditional part of the reception.

41. Ang pag-asa ay nagbibigay ng kahulugan sa buhay ng mga tao sa pamamagitan ng kanilang mga pangarap at mga layunin.

42. Since curious ako, binuksan ko.

43. Taos puso silang humingi ng tawad.

44. Wonder Woman wields a magical lasso and bracelets that can deflect bullets.

45. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

46. Cheap sunglasses like these are a dime a dozen.

47. Gaano kalaki ang bahay ni Erap?

48.

49. The Discover feature on Instagram suggests accounts and content based on a user's interests and interactions.

50. Nagsisindi ng ilaw ang mga bahay tuwing takipsilim.

Similar Words

jobs

Recent Searches

balinganjobsellingnagsilapittalentdumaansumigawyourself,kananpaksaelectorallistahantamanogensindemagbigayancarbonmenoswalngpangingimiclientsabrilsinkblazingbarrocoapoypatihiningibinulongmorenasystematiskexamsumusunowalismatchingpinyapartyumingitulamearnparagraphscaregrewrefersfatwatchdaangreenurilabingsoonmapaikot18thwideglobalayudamajorvasquesenforcingdidingpromotingratemakilingmulti-billionkasinggandaipasokagilitycondoilanconsideredconcernslutuinandyneversambitipinalutothreepaceferrerconectantruechefconstitutionmarkedeachtiniklingweddingtutoringspreadalammarchsakalingganidcontent:daddykriskaabimalamangnatutulogincidenceearlynaubos19291970shuliutak-biyanaglalatangmagkakaroonnewspapersmakisigmakapangyarihangpapanhiklumiwanagopgaver,nakatirafotostumawagkapangyarihangnakaka-inmagpaliwanagkagandahagmagkaibiganpaki-translatecassandranag-aalanganbarung-barongikinasasabiknagbakasyonmagtatagalpagkalungkotadvertising,tinutopparehongmagtataasmumuntingpinakidalanaliwanaganmagsi-skiingdiscipliner,kapasyahanbusinessesnaiyakliv,balediktoryannai-dialmaanghangjejumauupohayaangsinusuklalyanpagtatanimprodujoinilistapamasahehumalomagpagupitmalulungkotpiyanobinge-watchingteknologinabiawangtinatanongkainitanganapinsakyankilayautomatisknakainomtuktoktutusinmagsisimulakuripotbusytawasumimangotlasajennykunehorolandmadalingrememberedmanilanandiyankulisapumibigtanawaregladodiseasesadvertisinghuertohinukaypalitanpayapangandreadyosagawanaglulusakginoongumisiptirangakmang