Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "job"

1. A dedicated employee goes above and beyond their job requirements to contribute to the success of their organization.

2. Accepting the job offer without reading the contract was a risky decision.

3. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

4. Aku sayang dengan pekerjaanku dan selalu berusaha memberikan yang terbaik. (I love my job and always strive to do my best.)

5. Has he started his new job?

6. He was warned not to burn bridges with his current company before accepting a new job offer.

7. I find that breaking the ice early in a job interview helps to put me at ease and establish a rapport with the interviewer.

8. I prefer to arrive early to job interviews because the early bird gets the worm.

9. If you quit your job in anger, you might burn bridges with your employer and coworkers.

10. Many people experience stress or burnout from overworking or job dissatisfaction.

11. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

12. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

13. She has quit her job.

14. She has started a new job.

15. She lost her job, and then her boyfriend broke up with her. That really added insult to injury.

16. The job market and employment opportunities vary by industry and location.

17. The presentation was absolutely flawless; you did a great job.

18. The uncertainty of the job market has led to many people rethinking their career paths.

19. Working in a supportive and positive environment can improve job satisfaction.

20. Workplace culture and values can have a significant impact on job satisfaction and employee retention.

Random Sentences

1. Eine Inflation kann auch die Investitionen in Forschung und Entwicklung beeinflussen.

2. Los héroes son modelos a seguir para las generaciones futuras.

3. It encompasses a wide range of areas, from transportation and communication to medicine and entertainment

4. Ipinanganak si Emilio Aguinaldo noong Marso 22, 1869, sa Kawit, Cavite.

5. Si Pedro ang tatay ko at siya ang nanay ko.

6. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

7. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

8. "The better I get to know men, the more I find myself loving dogs."

9. Saan nangyari ang insidente?

10. Ang kanyang hinagpis ay nakikita sa kanyang mga mata, kahit hindi niya ito binibigkas.

11. Tengo muchos sueños y aspiraciones. (I have many dreams and aspirations.)

12. The momentum of the car increased as it went downhill.

13. Mabini Hall ang tawag sa gusali kung saan nagsisimula ang mga klase sa Polytechnic University of the Philippines.

14. Mas maganda si Bingbing kaysa kay Jingjing.

15. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

16. Ang kahusayan ng isang guro ay dapat na itinuring at kilalanin ng mga mag-aaral.

17. Ngunit lingid kay Roque, may namumuong lihim na pagkagusto sina Magda at Damaso sa isa't isa.

18. Aba makulit ang matandang ito! Lumayas ka rito! Doon ka sumisid sa dagat.

19. Sa brainly ako madalas nakakakuha ng ideya.

20. Walang pagtutol sa mga mata ng mga ito.

21. Imulat ang isipan sa mga kulay ng buhay.

22. Tantangan hidup dapat menjadi kesempatan untuk memperluas batasan diri dan mencapai potensi yang lebih besar.

23. Omelettes are a popular choice for those following a low-carb or high-protein diet.

24. L'argent est un élément essentiel de notre vie quotidienne.

25. He admires his friend's musical talent and creativity.

26.

27. Sa panahon ng digmaan, madalas masira ang imprastraktura at mga kabuhayan ng mga tao.

28. Ang korupsiyon ay laganap sa gobyerno.

29. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

30. Ibinili ko ng libro si Juan.

31. Ang mga mangingisda ay nagtatanim ng mga alon sa kanilang pagmamahal sa karagatan.

32. La realidad es que necesitamos trabajar juntos para resolver el problema.

33. Musk's companies have been recognized for their innovation and sustainability efforts.

34. Pinaliguan ng malamig na tubig ang bata na may bungang-araw.

35. The invention of the telephone and the internet has revolutionized the way people communicate with each other

36. Kumusta? Ako si Pedro Santos.

37. Huwag magpabaya sa pag-aasikaso ng mga responsibilidad sa tahanan o sa trabaho.

38. Nahuli na nang mga pulis ang mga nagtutulak ng illegal na droga sa kanilang lugar.

39. Holy Week er en tid til eftertanke og refleksion over livets cyklus og død og genfødsel.

40. He admired her for her intelligence and quick wit.

41. Ang blogger ay nagsusulat ng mga blog post upang ibahagi ang kaniyang mga opinyon at karanasan.

42. Maglalaro ako ng tennis. Ikaw?

43. I don't want to go out in this weather - it's absolutely pouring, like it's raining cats and dogs.

44. Ailments can impact different organs and systems in the body, such as the respiratory system or cardiovascular system.

45. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

46. Sa panitikan, maaari nating makilala ang mga kilalang manunulat ng bansa.

47. Dogs can provide a sense of security and protection to their owners.

48. Ang pagsasayaw o pagsali sa isang grupo ay nakagagamot sa aking kaluluwa.

49. Nagsusulat ng pangungusap ang mga estudyante.

50. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

Similar Words

jobs

Recent Searches

sinungalingjobtengakubonanoodroondialledbesesinternacionalsipagvelstanddibadagatadobopublishing,iskedyulmeronbangkosumisilipsacrificemariamatamispeepleomanuscriptmoderneremaintiketredigeringsupremecenterlikestinitirhanmedidafamefrabotejanepaybasahansubjectabonooverallipagbilitaposandamingbalingbroughtnangangambangipinanganakgamesmalimitinalokinisspendingsorryiconbalelabingumiilingtomarmulbowoverviewrightdanceseeninterpretingbadsutileksaytedputahemacadamiainalisstoreputingipinalitdatahellogitaraallowedaggressionrobertestablishedreleasedcornerevilnariningairconkapilinghetoulammakisuyotanonggumapangtotoongskyldes,linggo-linggopanohesussagasaansubalitsunud-sunodsynctoolfidelnagpuyoslutofar-reachingadicionalesamparoclientssinunodproperlybatishortlearningkagandahanmakatarungangfollowing,mamanhikanpulang-pulahitsuranagpaalampagpapasanisugatmicamagagawanalakimahinangpinapalonawawalabalitanaglakadpagkakapagsalitanakakadalawpinagtagpolacsamanapinakamagalingnagmungkahikaaya-ayangmang-aawitressourcernetinaasansiopaopapalapitkakilalacaracterizapinalalayasrenacentistamagkabilangkantahanguitarramakaraanlumuwaskagipitansasakyanumakbaykwartonagdabogpamagatyumabangnagbabalaarbularyotutungokulunganapatnapubiyernesebidensyanababalothuninatuloylaamangtanawninyongmassachusettsnapawinatutuloggusalipananakitsampungbutterflykamaliancampaignsaregladomaatimgjortnasuklamngayonsagotcashnanaloandresmakinangprosesopersonjennyhastahanginilagay