Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

8 sentences found for "increased"

1. Baby fever can be accompanied by increased attention to one's physical health and well-being, as individuals may want to ensure the best conditions for conception and pregnancy.

2. It is often characterized by an increased interest in baby-related topics, including baby names, nursery decor, and parenting advice.

3. Online traffic to the website increased significantly after the promotional campaign.

4. The momentum of the car increased as it went downhill.

5. The patient's family history of high blood pressure increased his risk of developing the condition.

6. The patient's family history of leukemia increased their risk of developing the disease.

7. This has led to increased trade and commerce, as well as greater mobility for individuals

8. Women's health issues, such as reproductive health and breast cancer, have received increased attention in recent years.

Random Sentences

1. Sa ganang iyo, bakit hindi lahat ng tao ay pantay-pantay ang oportunidad sa buhay?

2. Muchas personas disfrutan tocando instrumentos musicales como hobby.

3.

4. La science a permis des avancées significatives dans la médecine.

5. Protecting the environment involves balancing the needs of people and the planet.

6. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

7. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

8. One of the most significant areas of technological advancement in recent years has been in the field of communications

9. Mahal ko ang pusa ko dahil malambing siya.

10. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

11. Esta comida está bien condimentada, tiene un buen nivel de picante.

12. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

13. Limitar el consumo de alimentos procesados y azúcares añadidos puede mejorar la salud en general.

14. "Laging maging handa sa anumang sakuna," ani ng opisyal ng gobyerno.

15. Ang saya ng Pinoy fiesta, lalo na kapag may parada at sayawan.

16. L'enseignement est un métier noble qui consiste à transmettre des connaissances aux élèves.

17. It's never a good idea to let the cat out of the bag when it comes to confidential information - it can have serious consequences.

18. Guten Abend! - Good evening!

19. Bakit di mo 'to sinabi sa akin?

20. Ang kasama naming lalaki ang nag-piloto nito.

21. Isang umaga habang si Nicolas ay nasa paaralan ay nabalitaan niya na paalis na sina Helena papunta sa ibang bansa mamayang hapon.

22. They have bought a new house.

23. Sa pagguhit, mahalaga ang pagpapakita ng depth at perspective sa mga larawan para maging realistic ang mga ito.

24. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

25. Las plantas proporcionan oxígeno y son esenciales para mantener el equilibrio ecológico.

26. Bigyan mo ng pera ang pulubi.

27. La rotación de cultivos es una práctica agrícola que ayuda a mantener la salud del suelo.

28. Huh? Paanong it's complicated?

29. I don't think we've met before. May I know your name?

30. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

31. Dahil sa biglaang trapik, na-late ako sa meeting ko kanina.

32. Iyon ang totoo, sinasabi niya sa sarili.

33. They do yoga in the park.

34. Electric cars have a lower center of gravity, which can improve handling and stability.

35. Bumoto ka nang ayon sa idinidikta ng iyong puso.

36. El cultivo de hortalizas es fundamental para una alimentación saludable.

37. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

38. Ang kuripot mo naman, minsan lang ako magpalibre eh.

39. Huwag ka nanag magbibilad.

40. Masaya ako tuwing umuulan at kapiling ka.

41. Sa muling pagkikita!

42. Napakahalaga ng talambuhay ni Sultan Kudarat sa pag-unlad ng Mindanao bilang isang lider.

43. Oscilloscopes display voltage as a function of time on a graphical screen.

44. Ilang tao ang pumunta sa libing?

45. It's nothing. And you are? baling niya saken.

46. Landet har en omfattende social sikkerhedsnet, der sikrer, at alle borgere har adgang til sundhedspleje, uddannelse og sociale ydelser

47. The king's legacy may be celebrated through statues, monuments, or other memorials.

48. Ano ang natanggap ni Tonette?

49. Omelettes are a popular choice for those following a low-carb or high-protein diet.

50. My boyfriend took me out to dinner for my birthday.

Recent Searches

increasedmereoftenmetodemarahilmasinopi-googlekasalukuyankasintahanautomationelectionskawaldoublemungkahitatanggapincynthiashiftdawnapakahabaguiltykisapmatanahigitankaytayomasayaagam-agampagluluksakamiasbangkanglingidmadungistumatanglawpanitikan,mismojosekakaroonmadulaspantalongpawisagilapilitfeedbackactivityflaviobungadgeneinventionfloorkubokinangusomediaano-anorestkapit-bahayencounterpagkakamaliclassespanghihiyangopgaver,nagsunuranpamahalaankalakihannagtutulakmakikipaglaronagpaalamlumiwagnagmakaawapalapunonagcurvekumidlathouseholdspinagbigyannaabutankabuntisanatensyongminamahalmagsi-skiingnagmadalingnagpakunotnakaraanpinalakingtrainingpacespeedstrengthtakeofteagepalagingagoswalletauditsarilingdioxideduloexhaustedhanapbuhaynakikini-kinitakumembut-kembotmakalaglag-pantynyohinagpisnagmamaktolkitang-kitananlilimahidmakapangyarihanpagka-maktolpunongkahoygratificante,makikitamagbabakasyonpaboritonumerososvisualafternoontindignagsuotkumakainsumusulatmahiyanapapahintonakikitangmahinognakakatabanakauwimakikiligofestivalesnapagpagkainismangyarituktokinuulamnagsinetaxinasaanmaanghangnakabibingingmabatongyumaolabinsiyamtumikimdinalalikodpaligsahanmahabolnagwalisdamdaminiiwasankumanannakaakyatsignalnakapagproposerenacentistakatamtamandahilbiyasbantulotpalitanmaestrasikatkatagangcantidadgirayobservation,tawaggataspinapakinggankuligliginutusanlapisbeforekalayaankauripopularsikowasakdagateducationgardenwaterpebreroaaisshinvitationbodegalegacypirata1954palikuranmaidhinanakitkaragatanrolandgulangnapakoalagaibilitiboktela