Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "nagbenta"

1. Nagbenta ng karne si Mang Jose kay Katie.

Random Sentences

1. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

2. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

3. Software er også en vigtig del af teknologi

4. Kebahagiaan dapat ditemukan dalam hubungan yang sehat dan penuh cinta dengan keluarga, teman, dan pasangan.

5. Kinagabihan, wala si Pinang sa bahay.

6. Ang pag-aaral ng tao ay hindi lamang sa labas kundi pati sa kaibuturan ng kanyang pagkatao.

7. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

8. Ano ho ang tingin niyo sa condo na ito?

9. She has quit her job.

10. Hindi nag-iingat ang bata kaya siya naaksidente sa kalsada.

11. Cancer awareness campaigns and advocacy efforts aim to raise awareness, promote early detection, and support cancer patients and their families.

12. Bumibili ako ng pagkain sa grocery store.

13. El graffiti en la pared está llamando la atención de la policía.

14. Ano ang ginawa niya pagkatapos ng giyera?

15. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

16. He forgot his wallet at home and therefore couldn't buy lunch.

17. Lumipad palayo ang saranggola at hindi na nila nakita.

18. It's important to be careful when ending relationships - you don't want to burn bridges with people you may encounter in the future.

19. Min erfaring inden for dette område har været meget givende.

20. Nogle lande og jurisdiktioner har lovgivning, der regulerer gambling for at beskytte spillerne og modvirke kriminalitet.

21. Kapag dapit-hapon, masarap magpahinga sa parang habang nakatingin sa mga bituin.

22. The feeling of frustration can lead to stress and negative emotions.

23. The company is exploring new opportunities to acquire assets.

24. Pedro at Juan ang mga pangalan ninyo.

25. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

26. Limitations can be a result of societal or systemic inequalities and discrimination.

27. Nagtatrabaho ako tuwing Martes.

28. Patients and their families may need to coordinate with healthcare providers, insurance companies, and other organizations during hospitalization.

29. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

30. The river flows into the ocean.

31. Cocinar en casa con ingredientes frescos es una forma fácil de comer más saludable.

32. Nasa sala ang telebisyon namin.

33. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

34. Ang ganda na nang bagong Manila zoo.

35. Nakita ko ang mga kapatid ko noong pasko.

36. The widespread use of digital devices has led to an increase in sedentary behavior and a decrease in physical activity

37. Opo. Iiwasan ko po si Anthony. putol ko sa sinasabi niya.

38. The grocery store offers a variety of fresh produce, including fruits and vegetables.

39. Ayaw mo ba akong kasabay? maya-maya eh tanong ni Anthony.

40. Alles hat ein Ende, nur die Wurst hat zwei.

41. I discovered a new online game on a gaming website that I've been playing for hours.

42. Sumasakay ako ng taksi sa umaga araw-araw.

43. Practice makes perfect.

44. Madalas akong nagbabasa ng libro sa hatinggabi dahil hindi ako makatulog.

45. No puedo controlar el futuro, así que "que sera, sera."

46. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

47. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

48. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

49. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

50. Ang paggamit ng droga ay maaaring magdulot ng pagkawala ng trabaho, pamilya, at mga kaibigan dahil sa mga problemang may kinalaman sa droga.

Recent Searches

paostumigilnagbentamagamotprincipalesgospelbutikifysik,unidospatakbonakatuonisinagotkontinentengmagagamitberegningernaglokohanmarasigannakahainkuwentoalapaapnaawasementongtamarawcaracterizapwedengtinuturopaligsahanmatumalisinusuotpakiramdamtulisanngitihahahapagbabantamagtatakacruzbumaligtadrenacentistafrancisconakitulogkaraniwangsisentakatagangmalasutlasahodaustraliaadvertisingpangalananmaranasannagplaymagtanimbinawianmaawaingginoongnakapikitprotegidokumantamatutulogtsinaexigentenabigaystatingdeterminasyonsagutinnangyaripagkatsapotmatesawinskargangmaliitiniisippakisabipaldawaiterinventadoalaksumimangotngisibaryohinintayawardinintaydadalobagamakinseconsumeosakaiskedyulwastemagtipidmalamangnaglabananaksidenteinatakeproudsitawkatagamaistorboanavivasumingitejecutanlalakefollowedkumbentosilyausoniluloncapitalitinagokabosesvalleysinampalgamitinkatandaangrammargraphictsetanodiilanmininimizeiikliitutollookedmembersaumentarhomesbriefabononagbungabagopostcardcollections1980nyagisingwestaccedersinunodbuwanhangaringconsistanimoysenateworddulotreplaced1787continuemapaikotkumaripasbilisipinabaliksinabinamingbuwalmarsoadditionjerryelectionshumanowidespreadbaulfireworksjacepitakaoliviaconectadosdalandanbatiroonmatagpuanibanganiafternoonreportkiloeducationaladventnuclearfistssutiliosislafindactingleecondolaylayinalalayanworryluiscompartenitinaliforcespalagingspendingincrediblesemillas