Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "sociales"

1. El arte puede ser utilizado para fines políticos o sociales.

2. El uso de las redes sociales está en constante aumento.

3. Es importante ser cuidadoso con la información personal que se comparte en las redes sociales.

4. Es importante tener en cuenta la privacidad y la seguridad al utilizar las redes sociales.

5. Estos dispositivos ejecutan sistemas operativos como Android o iOS y pueden descargar y ejecutar aplicaciones de diferentes categorías, como juegos, redes sociales, herramientas de productividad, entre otras

6. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

7. La internet nos permite comunicarnos con personas de todo el mundo a través de correo electrónico, redes sociales y otros medios.

8. La música es una forma popular de entretenimiento en bodas, fiestas y otros eventos sociales.

9. La música puede ser utilizada para fines políticos o sociales.

10. Las redes sociales permiten a las personas conectarse y compartir información con amigos y familiares.

11. Las redes sociales pueden ser adictivas y consumir mucho tiempo.

12. Las redes sociales pueden ser un lugar para descubrir nuevos productos y tendencias.

13. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

14. Las redes sociales pueden ser una fuente de entretenimiento y diversión.

15. Las redes sociales pueden ser una fuente importante de noticias y eventos actuales.

16. Las redes sociales pueden ser una herramienta para hacer networking y hacer crecer tu carrera.

17. Las redes sociales son una herramienta útil para conectarse con amigos y familiares.

18. Las redes sociales son una herramienta útil para encontrar trabajo y hacer conexiones profesionales.

19. Las redes sociales son una parte fundamental de la cultura digital actual.

20. Las redes sociales son una parte importante de nuestras vidas hoy en día.

21. Las redes sociales son una plataforma para compartir fotos y videos.

22. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

23. Las redes sociales también son un medio para hacer negocios y promocionar productos.

24. Las redes sociales tienen un impacto en la cultura y la sociedad en general.

25. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

26. Les enseignants peuvent encadrer des clubs étudiants pour promouvoir les compétences sociales et artistiques des élèves.

27. Les sciences sociales étudient le comportement humain et la société.

28. Muchas personas utilizan las redes sociales para expresar sus opiniones y puntos de vista.

Random Sentences

1. Sa bawat tugtugin ng kundiman, nabibigyang-katarungan ang mga pinagdaanang sakit at luha ng mga taong nagmamahalan.

2. Binuksan niya ang tarangkahan nang tahimik upang hindi magising ang mga bata.

3. Sa takip-silim, nakakapagbigay ng magandang silip sa mga bituin at buwan.

4. ¡Muchas gracias!

5. She has run a marathon.

6. Nasa gitna ng kagubatan kaya hindi mo maiiwasang humalinghing nang malalim.

7. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

8. Pinagsabihan siya ng guro dahil napansin ang kanyang pagiging maramot sa mga kaklase.

9. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

10. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

11. Ang kaibuturan ng kanyang pagkatao ay hindi mo agad makikita.

12. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

13. Talaga ba Sharmaine?

14. Hinagud-hagod niya ang mga kamao.

15. Pero mukha naman ho akong Pilipino.

16. Bien que le jeu puisse être amusant et excitant, il est également important de se rappeler qu'il peut avoir des conséquences négatives s'il n'est pas géré de manière responsable.

17. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

18. Mas masaya naman ako pag napapasaya kita eh.

19. Sana, binigyan mo siya ng bulaklak.

20. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

21. The success of Tesla has had a significant impact on the automotive industry, inspiring other automakers to invest in electric vehicle technology and develop their own electric models.

22. All these years, I have been cherishing the relationships and connections that matter most to me.

23. Napangiti ang babae at kinuha ang pagkaing inabot ng bata.

24. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang mahalin?

25. I am absolutely grateful for all the support I received.

26. Hindi niya agad napansin ang sugat hanggang sa sinubukan niyang salatin ito.

27. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

28. Binili ni Rita ang damit sa tindahan.

29. We have been painting the room for hours.

30. Sa hinaba-haba man daw ng prusisyon, sa simbahan din ang tuloy.

31. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

32. The celebration of Christmas has become a secular holiday in many cultures, with non-religious customs and traditions also associated with the holiday.

33. Ginaganap ang linggo ng wika ng Agosto.

34. I played an April Fool's prank on my roommate by hiding her phone - she was so relieved when she found it that she didn't even get mad.

35. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

36. El cultivo de olivos es una actividad tradicional en el Mediterráneo.

37. Nagpipiknik ang pamilya namin kung maaraw.

38. Scissors should be kept sharp to ensure clean and precise cuts.

39. Gusting-gusto ng kanyang magtatapos na anak ang minatamis na garbansos.

40. The United States is the third-largest country in the world by land area and the third most populous country in the world.

41. Ang panitikan ay mahalagang bahagi ng kultura ng isang bansa.

42. El uso de drogas es un problema grave en muchas sociedades.

43. Los sueños nos inspiran a ser mejores personas y a hacer un impacto positivo en el mundo. (Dreams inspire us to be better people and make a positive impact on the world.)

44. The song went viral on TikTok, with millions of users creating their own videos to it.

45. Algunas personas se dedican a crear arte como su profesión.

46. La science de l'énergie est importante pour trouver des sources d'énergie renouvelables.

47. Kitang-kita sa muka ng ina ang pagtataka dahil may dalang basket na puno ng mga gulay at prutas.

48. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

49. Da Vinci estuvo interesado en la anatomía y realizó numerosos estudios sobre el cuerpo humano.

50. Christmas is an annual holiday celebrated on December 25th to commemorate the birth of Jesus Christ.

Recent Searches

manakbokinakainsocialesnasawinagtutulungannaglalatangnagkakatipun-tiponhinagud-hagodgreatertatlumpungbibisitamagkaparehosikre,nahawakanmagagandanggulatmakikipaglaronabubuhayinvestingisasabadnakatapattumagalnagkalapitdekorasyonnagnakawnapaiyaklalawigankumakantamaipapautangpaki-chargeartistkinasisindakanhululinggongnagtalagamagtiwalamaghahabikaarawan,madungisnagpuntaarbularyonaglulutoyumabangsistemasdispositivomagtagoitinatapatpwedengtaxiproducemagselosika-50regulering,isasamamamahalinnagbabalanatatawanilalangpatongcampaignsgustongmukhadealmatangkadkatolikobihasavegasarkilaindividualshoyanghelpamamahingaganitotamismarilouadecuadohumpayguidancehinogmaidnenainakyatautomationpamimilhingnataposinihandakapaganapitongnagbasadyipiikliklasrumdaladalabiglaprutasaudiencenagdarasal1954sumisilipmuntingaywanhangaringwritinghehenoohidingpopcorntuwanglapitanfar-reachingpagkasabimerchandisenaawalulusogforcesbirosinabireservedreducedbluepakpaklargertryghedsumindistep-by-stepcablebetweenbinilingfeedbackdraft,beyondenvironmentamingcolourofteneedlucyaudio-visuallypakibigayplatformnagbiyayanakaraanmatulisharplamanideasubalitmagkakaroonhanginstruggledo-onlinedalawcontentsumakayvistmagalanglilimyumaobanalpangungutyanakikilalanglangawinuunahanmahahawaebidensyauniquenakakitanagtitiisnakapangasawanakikini-kinitanapapasayamakapangyarihanmagkaibigankinagagalaktravelernakatirafotospinagpatuloynapipilitannagdiretsonabighaninapakamotdiscipliner,kalayuanatensyonghahatolmasayahinnagkapilatrestlumakastumahanmagpagupitsumusulatmungkahicorporationmagpapigilproductividadmasaksihanibinili