Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "became"

1. Einstein was a refugee from Nazi Germany and became a U.S. citizen in 1940.

2. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

3. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

4. James Monroe, the fifth president of the United States, served from 1817 to 1825 and was known for his foreign policy doctrine that became known as the Monroe Doctrine.

5. LeBron James played high school basketball at St. Vincent-St. Mary High School, where he gained national recognition and became a basketball prodigy.

6. Musk was born in South Africa and later became a citizen of the United States and Canada.

7. This was a time-consuming process, and it was not until the invention of the automatic switchboard in 1892 that the telephone system became more efficient

Random Sentences

1. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

2. Ano bang sakit niya? Inuulcer pa rin ba siya?

3. The nature of work has evolved over time, with advances in technology and changes in the economy.

4. Nagkakamali tayo sapagkat tayo ay tao lamang.

5. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

6. Elektroniske apparater kan hjælpe med at overvåge og forbedre kvaliteten af ​​produkter.

7. Kailan siya nagtapos ng high school

8. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

9. Disse inkluderer terapi, rådgivning og støttegrupper.

10. Many people experience stress or burnout from overworking or job dissatisfaction.

11. Ako ay nagtatanim ng mga orchids sa aking mga paso.

12. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

13. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

14. Sa pagpapabuti ng bansa, dapat isipin ang kinabukasan ng mga susunod na henerasyon.

15. Sa paligid ng balde, nakikia niya ang kanyang anino.

16. Omelettes are a popular choice for those following a low-carb or high-protein diet.

17. Madami talagang pulitiko ang kurakot.

18. Hindi pa ako kumakain.

19. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

20. Sa dakong huli, naitama ko rin ang aking mali sa trabaho.

21. La tos seca es una tos que no produce esputo o flema.

22. The website's online store has a great selection of products at affordable prices.

23. The love that a mother has for her child is immeasurable.

24. I have been working on this project for a week.

25. Twitter has implemented features like live video streaming, Twitter Spaces (audio chat rooms), and fleets (disappearing tweets).

26. Isang araw sa kainitan ng tanghali, isang mahiwagang babae ang dumating at kumatok sa mga pintuan ng mga taong bayan.

27. Doa dapat dilakukan dalam bahasa apapun, asalkan dipahami oleh orang yang melakukan doa.

28. Nanonood nga muna ito at saka lang bumaba sa nananalong grupo.

29. Inaamin ko na ang pagkakamali ko.

30. Salatin mo ang ibabaw ng mesa para makita kung may alikabok.

31. Diversification is a strategy that involves spreading investments across multiple asset classes to reduce risk.

32. Tinignan ko siya sa nagtatanong na mata.

33. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

34. Ano ang nasa bulsa ng bag niya?

35. Oh sige na nga sabi mo eh. hehe.

36. Hendes personlighed er så fascinerende, at jeg ikke kan lade være med at tale med hende. (Her personality is so fascinating that I can't help but talk to her.)

37. Sabi ko bumangon ka jan! Hoy!

38. I do not drink coffee.

39. A lot of traffic on the highway delayed our trip.

40. Nay, ikaw na lang magsaing.

41. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

42. The new factory was built with the acquired assets.

43. Nagbigay ng biglaang meeting ang boss ko kanina kaya hindi ako nakapaghanda.

44. Fui a la fiesta de cumpleaños de mi amigo y me divertí mucho.

45. Hoy en día, el internet es una parte integral de la vida cotidiana.

46. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

47. Ang tubig-ulan ay maaaring magdulot ng malinis na hangin sa pamamagitan ng pag-alis ng polusyon sa hangin.

48. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

49. Nagpabakuna kana ba?

50. Der er forskellige identiteter inden for transkønnethed, herunder non-binær og genderfluid.

Recent Searches

becamenilaosshinesguerrerouniversitiescarmenvitaminadvancedekorasyoniniibigtsinashadesrisemaibacompositoreskamalayanskyldeshinukayindividualumalismarkedespigasawaiyonnooburmaafterpagodkerbpetsangartskanangamerikacomunesnatanggapsulingansakineventsbubongtagalsumapitmanananggalworldwealthinomstoretrainsharmfulipasokpahiramagoscantidadpetsaturoyesconsiderrobertspellingrelevantguiltycakeentrancesaritakilongniyognahulaansciencepusorailwaysbabesolidifypinagsikapanmapcarsnagkitatagumpaygustomakabilipagpilimananakawmangahasmayuwakmakikitulogmatalinoerlindapagguhitnaguguluhangsetyembrebloggers,umiiyakwashingtonclubagapaga-alaladisappointnapapahintostylesfotosnakakamitnapatawagnakatuwaanglalakadculturamakikiraanhinipan-hipancurrentpag-aalalagovernmentpumitasnakakatandakahonghanapbuhaybayawaknakaliliyongpansamantalanapatigilmontrealpagkabiglafrancisconavigationskyldes,nakakaanimnagdadasalpaosmagpapigilpumuntafysik,maasahankinikilalangdepartmentnaguusapsisentasiyudadmasukoldakilangnasilawtherapeuticsherramientassamantalangmahabolnakatinginbinentahanseparationtanganbutibutopaakyatnatitiraanumanitinaasanubayankababalaghangiikotsayabanalkulisapprotegidoalanganmadadalapatongtanyagrobinhoodasukalmarinignapasukocreativekainandisciplingasmenganidmakinangpinagsisidlantulangwinsfiverrupuannapapikitganitowaiterbuhokgreatlysilapatiencelaranganbasahinsakimflavionapagodmukamalambingchoisumigawvistmalumbayibinalitanglegacymeronpiging