Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

27 sentences found for "provide"

1. A wife's love and devotion can provide a stable foundation for a long-lasting marriage.

2. Adopting a pet from a shelter can provide a loving home for an animal in need.

3. Basketball players wear special shoes that provide support and traction on the court, as well as protective gear such as knee pads and ankle braces.

4. Dogs can provide a sense of security and protection to their owners.

5. Dogs can provide emotional support and comfort to people with mental health conditions.

6. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

7. Electric cars can provide a smoother and more responsive driving experience due to their instant torque.

8. Emphasis can be used to provide clarity and direction in writing.

9. Groups on Facebook provide spaces for people with shared interests to connect, discuss, and share content.

10. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

11. It is important for individuals experiencing baby fever to communicate their feelings openly with their partner, family, or friends, as they can provide support and understanding.

12. It's important to provide proper nutrition and health care to pets.

13. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

14. Many schools and universities now use television as a way to provide distance learning

15. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

16. Owning a pet can provide a sense of purpose and joy to people of all ages.

17. Owning a pet can provide companionship and improve mental health.

18. Platforms like Zoom and Skype make it easy to connect with students or clients and provide your services

19. Scissors have handles that provide grip and control while cutting.

20. The dedication of healthcare professionals is evident in their tireless efforts to provide care and save lives.

21. The dedication of parents is evident in the love and care they provide for their children.

22. The king's role is to represent his country and people, and to provide leadership and guidance.

23. The stock market can provide opportunities for diversifying investment portfolios.

24. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

25. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

26. Work can also provide opportunities for personal and professional growth.

27. Working can provide a sense of purpose, achievement, and fulfillment.

Random Sentences

1. I can't access the website because it's blocked by my firewall.

2. Ang pag-asa ay nagbibigay ng inspirasyon sa mga tao upang magbigay ng tulong at suporta sa ibang tao.

3. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

4. May isa sa mga taong bayan ang nakakita nang isubo ng matanda ang bunga.

5. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

6. Bayaan mo na nga sila.

7. She studies hard for her exams.

8. Ano ang gagawin mo sa Linggo?

9. Tatanggapin ko po ang anumang kaparusahan.

10. Mataas sa calcium ang gatas at keso.

11. People who give unsolicited advice are a dime a dozen.

12. In 1977, at the age of 42, Presley died of a heart attack

13. Ano-ano pa po ang mga pinaggagagawa ninyo?

14. Patuloy ang labanan buong araw.

15. Mahirap maging may agam-agam sa buhay dahil ito ay maaaring magdulot ng pagkabalisa.

16. Congress is divided into two chambers: the Senate and the House of Representatives

17. Ang monumento ni Mabini ay matatagpuan sa may lalawigan ng Batangas.

18. At sa paglipas ng panahon, naging malakas na ang lalaki na nakilala nilang Damaso.

19. Pakibigay na lang ang mensahe ko kay Miguel kung hindi ko siya maabutan.

20. Los amigos que tenemos desde la infancia suelen ser los más cercanos y leales.

21. Saan naman? nagtatakang tanong ko.

22. Pumupunta ako sa Negros tuwing Abril.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. This shows how dangerous the habit of smoking cigarettes is

25. Sa aming pagtitipon, nagkaroon ng palaro at paligsahan na nagpapakita ng diwa ng bayanihan.

26. Napaiyak si Aling Pising ng makita ang mga tuyong kahoy at posporo sa ilalim ng kanilang bahay.

27. We need to reassess the value of our acquired assets.

28. Ano ang pinanood ninyo kahapon?

29. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

30. Kumakain ng tanghalian sa restawran

31. Mag o-online ako mamayang gabi.

32. Inalagaan niyang mabuti hanggang sa ito'y magbunga.

33. The stock market gained momentum after the announcement of the new product.

34. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

35. Madalas na naglulusak sa dumi ang mga bakuran.

36. Naalala nila si Ranay.

37. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

38. Comer saludable es esencial para mantener una buena salud.

39. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

40. Vi skal fejre vores helte og takke dem for deres indsats.

41. Sa kaibuturan ng kanyang pagkatao, mahal niya ang pamilya niya.

42. El autorretrato es un género popular en la pintura.

43. Matagal-tagal ding hindi naglabada ang kanyang ina, nahihiyang lumabas sa kanilang barungbarong.

44. La creatividad es fundamental para el desarrollo de ideas innovadoras.

45. El agua es utilizada en diversas actividades humanas, como la agricultura, la industria y el consumo doméstico.

46. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

47. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

48. Lumalaon ay dumarami ang tao sa paligid at ang pulis na umuusig ay tila siyang-siya sa kanyang pagtatanong at pagsusulat sa kuwaderno.

49. Marami ang dumarayo hindi lamang para bumili ng mga disenyo kundi upang makita rin ang paggawa ng bata.

50. Ang guro ang pinagpalaluan ng lahat ng kanyang mga estudyante dahil sa kanyang kabaitan.

Similar Words

provided

Recent Searches

provideswimmingmasayangnegro-slaveslooblumungkotnagsiklabpinanoodniluloncreateknowledgecanteenilingjunjunrangeinfinityberkeleyhumanapmitigateclientepisiclassmateimpactedmagpapaikotibat-ibangnagkakatipun-tiponcolornagmumukhananlilimahidpananimimulatmaglaropakikipaglabannanghuhulipanimbangnabiglapinalambotnatatawanahihirapanartistsdealplacesakimyunpinagbubuksanoutlalakikeepingmamulottingineffectpinagkasundobingiinantaynangalaglagpakpakapollonootig-bebeintedejarefersmagpuntadependingfeedbackmababasag-ulogayundintrasciendekastilabiyayanguloillegalsynligebasanakapilaclipmakapilingwaitscalekahalagamukahtoolsnegrospintonakikihalubilopagkakapagsalitarumaragasangtapekahonnataposroquetissueelementarynawawalalabiinispnagtatakaipaghandapaderhintuturotumambadpakialamyumaoitongrolldalawinsupportydelserarayverden,pantheonanak-pawispinagsikapanmatagpuanboardrodonanagpanggapthroughoutso-calledmaipapamanahoneymoonersmukamapagkalinganakapagproposetiniklingsuffernagwo-worknaturtablenagdaanrawsamakatuwidpinakamalapitsinikapoxygenhumiwapagbabasehanburdensasananghahapdinagpapasasamoviesmakikitanapakahangauusapanalmusalbatang-batahotdogmendioladiversidadtinykagustuhangnamumulotiwinasiwasmemorykapangyarihangnagpaiyakpinagalitannakaluhodikinasasabiklumalangoynagtagisancryptocurrencypagdudugokwartopanalangin1940nakapasapakakatandaantinutopnagpakunotnatigilangmakapagempakekongresomaibibigaymagbibigaypagbabayadpamumunokidkirannalalabingmasasayatinulak-tulakmagpa-paskobentahansinacompostelakaratulangtinatanongnabigyankaibatrentanerosculturaskampeonaloksabongperformanceinisiplunasnaramdambirthday