Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "smoking"

1. Ailments can be a result of lifestyle choices, such as smoking or excessive alcohol consumption.

2. Attractive packaging and expert publicity helped spread the addiction to smoking cigarettes even among the poorer sections of the people

3. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

4. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

5. I finally quit smoking after 30 years - better late than never.

6. It has been found that by abstaining from smoking a person may be cured of many diseases

7. Quitting smoking can also lead to improved breathing, better oral health, and reduced risk of premature aging.

8. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

9. Quitting smoking can improve one's health and reduce the risk of developing smoking-related illnesses.

10. Scientific evidence has revealed the harmful effects of smoking on health.

11. Smoking can also increase the risk of other health issues such as stroke, emphysema, and gum disease.

12. Smoking can be addictive due to the nicotine content in tobacco products.

13. Smoking can be harmful to others through secondhand smoke exposure, which can also cause health problems.

14. Smoking can cause various health problems, including lung cancer, heart disease, and respiratory issues.

15. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

16. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

17. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

18. Smoking cessation can lead to improved mental health outcomes, such as reduced anxiety and depression symptoms.

19. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

20. Smoking during pregnancy can harm the fetus and increase the risk of complications during pregnancy and childbirth.

21. Smoking is a global public health issue that requires ongoing efforts to prevent and reduce smoking prevalence.

22. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

23. Smoking is a leading cause of preventable death worldwide.

24. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

25. Smoking is more common among certain populations, such as those with lower socioeconomic status and those with mental health conditions.

26. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

27. Smoking-related illnesses can have a significant impact on families and caregivers, who may also experience financial and emotional stress.

28. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

29. Therefore, we should all steer clear of this bad habit of smoking cigarettes

30. This shows how dangerous the habit of smoking cigarettes is

Random Sentences

1. Ano ang ginugunita sa Thanksgiving Day?

2. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

3. The website's design is sleek and modern, making it visually appealing to users.

4. Sa dapit-hapon, madalas kaming magtungo sa park para maglaro ng frisbee.

5. Ginaganap ang linggo ng wika ng Agosto.

6. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

7. Huwag kang maniwala dyan.

8. Gusto ko na magpagupit ng buhok.

9. Banyak orang di Indonesia yang mengadopsi kucing dari jalanan atau shelter kucing.

10. Buwal ang lahat ng baldeng nalalabi sa pila.

11. Mahal ang mga bilihin sa Singapore.

12. Makikita mo sa google ang sagot.

13. Ang pagtanggap ng aking pagsisisi at pagpapatawad mula sa taong nasaktan ko ay nagpawi ng aking kalungkutan at panghihinayang.

14. Ano ang isinulat ninyo sa card?

15. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

16. Magkapareho ang kulay ng mga damit.

17. Paano kung hindi maayos ang aircon?

18. Hendes evne til at kommunikere med mennesker er virkelig fascinerende. (Her ability to communicate with people is truly fascinating.)

19. Kung wala kang maayos na balak, huwag kang umasa sa magandang resulta.

20. Hindi siya makapagtaas ng mabibigat dahil mababa ang kanyang timbang.

21. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

22. The feeling of falling in love can be euphoric and overwhelming.

23. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

24. Binalita ng magkasintahan ang kanilang kasal at ang nakatakdang araw ng pamamamanhikan.

25. Les prêts sont une forme courante de financement pour les projets importants.

26. Ayos lang. Basta alam kong safe kang nakauwi.

27. Nakaramdam siya ng pagkainis.

28. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

29. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

30. Kailangan nating magsumikap datapapwat marami tayong mga hamon sa buhay.

31. Red horse? Ikaw? nagtatakang tanong ni Genna.

32. Mayroong maraming tradisyon sa kasalan, tulad ng pagsusuot ng puting damit at paglalakad sa altar.

33. Sa kabila ng mahigpit na bantay, nangahas silang tumakas mula sa kampo.

34. Oo na nga, maganda ka na. Bagay sayo.

35. Sa pagdami ng mga tao, ang mga aso ay naging alaga nila sa kanilang mga tahanan.

36. Sobra. nakangiting sabi niya.

37. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

38. Babalik ka pa ba? nanginginig na yung boses niya

39. Nagtatanim ako ng mga bulaklak sa mga paso upang magkaroon ng mga colorful na dekorasyon sa loob ng bahay.

40. Sa facebook kami nagkakilala.

41. The existence of God has been a subject of debate among philosophers, theologians, and scientists for centuries.

42. Hindi ka nag-iisa, mayroon kang kaulayaw na handang tumulong sa iyo.

43. Noong 2019, nanalo si Carlos Yulo ng gintong medalya sa World Artistic Gymnastics Championships.

44. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

45. Ein frohes neues Jahr! - Happy New Year!

46. Hi Gelai!! kamusta naman ang paborito kong pamangkin?

47. Siempre es gratificante cosechar las verduras que hemos cultivado con tanto esfuerzo.

48. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

49. The patient experienced hair loss as a side effect of chemotherapy for leukemia.

50. Jeg er nødt til at skynde mig, ellers kommer jeg for sent. (I have to hurry, otherwise I'll be late.)

Recent Searches

smokingpaanantsonggohalamanangnaririnigpantheonsumuwayfacultythereforevaledictorianumaapawnapakalusogpanalanginactionheftygodtdanzamorningydelserhulihankabundukanbutihingjeetgigisinglivesipinagdiriwangnaliwanaganhawaksaloninternacionalfullbayadoccidentalaksiyonmalassinundannapapag-usapanbrightpakilutobaldemagazinesoraswesleynasundoquezonmunanapangitiadicionaleskatamtamanfuehimigfinishednaghihikabmakuhanglumabasopportunitiestobaccolindolmelissacocktailasiaexcitedanamay-bahayganidkampeonsiempremakauuwifavorkaagawmabuhaylandbayabasmaipapautangnaubosbungangservicesbagyongkatipunanyouplaguedmagtanghalianlandasmatatawaglightsnagawadetspeechhalamanannag-googleprojectsprosperlumindolferrerhumahagokbudoklunespalagimakawalanagpadalaumalisklimapatuyogapagadbahafollowingsangkalanindividualstanganfilmraisedpumuntaoutlinenapasobratungawnag-away-awaydakilangmarangyangfitaseanpinabulaanmabangomethodstakesseniormaghatinggabimaratingtuluy-tuloynakakaanimnegro-slavesiiyakpinakamasayabumililayasnobleproudkasuutanbernardokumalmamagdaandamingogoradgangkasaganaanundasikawtumingalaticketpagdaminilimasgawasementeryomalusognaiyakpassiontutubuinmaarimatabanginsidentetuloy-tuloymapilitangbakasyoneconomicmarangalayawmalakasdibaligawankapintasangpusamemoriapagtayorequirepumilimahusaylilynagisingparkpapapuntanag-aagawancomplexgutompinatutunayanlakasmakakabalikcontrolajunjunpinagsasasabimalimutanjansameilannag-uumirisikmurahulunag-umpisaarawpamanhikannaglaho