Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

5 sentences found for "waiter"

1. Ano ang ipinabalik mo sa waiter?

2. Hindi ko nakita ang kubyertos sa lamesa, kaya nagtanong ako sa waiter.

3. Pakibigyan mo ng tip ang waiter.

4. Sopas ang ipinabalik ko sa waiter.

5. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

Random Sentences

1. Minsan kailangan din nating magmangiyak-ngiyak para maipakita natin ang totoong nararamdaman natin.

2. Panahon ng pananakop ng mga Kastila

3. Maghapon nang nag computer ang kanyang anak.

4. All these years, I have been blessed with the love and support of my family and friends.

5. Ano ang binibili namin sa Vasques?

6. La música puede ser una carrera lucrativa para algunos músicos.

7. Danmark eksporterer mange forskellige varer til lande over hele verden.

8. Sa sobrang hiya, siya ay lumakad palayo mula sa harap ng maraming tao.

9. Oscilloscopes can be portable handheld devices or benchtop instruments with larger displays and advanced features.

10. Si Aling Juana ang tagalaba ng pamilya.

11. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

12. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

13. Wala akong pakelam! Dapat sayo pinapalo!

14. Inakalang ligtas ang lugar, pero may paparating palang bagyo.

15. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

16. Pinocchio is a wooden puppet who dreams of becoming a real boy and learns the importance of honesty.

17. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

18. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

19. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

20. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

21. Las pitones y las boas constrictoras son serpientes que envuelven a sus presas y las aprietan hasta asfixiarlas.

22. Pumunta ang pamilyang Garcia sa Pilipinas.

23. Hay muchos géneros de música, como el rock, el pop, el jazz y el clásico.

24. The baby is not crying at the moment.

25. Si Tom ay masipag sa trabaho, datapwat hindi marunong mag-ayos ng kanyang mga gamit.

26. Kan du skynde dig lidt? Vi skal nå bussen. (Can you hurry up a bit? We need to catch the bus.)

27. He juggles three balls at once.

28. Ipinatawag nila ang mga ito at pinagkasundo.

29. La literatura japonesa tiene una sutileza sublime que trasciende las barreras culturales.

30.

31. Einstein's contributions to science have had significant implications for our understanding of the universe and our place in it.

32. Kaninong payong ang asul na payong?

33. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

34. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

35. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

36. Pinuntahan ng pasyente ang doktor.

37. Uwi na tayo.. Ayoko na dito sa ospital..

38. Puwede bang pahiram ng isang kutsara? Nakalimutan ko ang aking sa bahay.

39. The bride looked stunning in her wedding dress, truly a beautiful lady.

40. Sinampal ko ng mahina yung pisngi ko.

41. Nagdiriwang sila ng araw ng kalayaan.

42. Medarbejdere kan deltage i mentorprogrammer for at forbedre deres færdigheder.

43. Matagal ko nang nararamdaman ang mga ito, kaya sana pwede ba kitang mahalin?

44. Hoy en día, el internet es una parte integral de la vida cotidiana.

45. Yeah. masayang sabi ni Chad with matching thumbs up.

46. Everyone knows that she's having an affair, but nobody wants to talk about the elephant in the room.

47.

48. Mi aspiración es ser una persona más compasiva y empática hacia los demás. (My aspiration is to be a more compassionate and empathetic person towards others.)

49. Hay una gran cantidad de recursos educativos disponibles en línea.

50. Ok na sana eh. Tinawanan pa ako.

Recent Searches

delewaitermagtatakalockdownnagdaoslaganapapollomini-helicopternagbiyaheformabuwayaasulnangingilidfulfillmentnapalakasbundoknakataasnakikiathankbobotoberetikababaihanrecibirtrycyclepagdudugosumagotconnectingrodrigueznagtatanongsellingnakangisitiyaninspirationfeeldyipmeankinakailangangnagtutulunganhatingcynthiamasaksihannag-aagawanstatelorenanagpipiknikbodahagdanhinamakmakauuwipresenceyakapmusicalesconclusion,paanoremoteindividualschildrenfar-reachingalintuntuninfertilizermakikipag-duetoprogrammingdilimhumahabacommissionsongspicsnakapangasawamakalipassuriincanadasementeryoeskwelahanyelokabosesconsiderednakahainmagka-apokonekinfinityattentionnapakanatayoformanimoutak-biyalumulusobmatuliskare-karekuwebaumiwaspasaheromarsotumirapasyenteiguhitvictorianagpasaninaloknananaginipnatutulogklasenglikodsumalipagkaraannapatignintumunoggrabepapasokjeromepagpapakalatnakumbinsiyamantuwang-tuwabowlcreativepagamutanisinumpabeingdiinmayamangoalkadalaspaglakibalahibotelefonmissionpartsdali-dalingleepaglalayagattractivemagulayawiwanblessincreasecitizenalimentodurifeedback,legendbehaviortumalablalakengtambayanhayaangrevolutioneretnaguguluhanlightspakilutodarkpopulationanapollutionahitapatnapuginaganoonskymanilaginacapitalsisteraabotpagkatpinyapayapangnakainomsuccessfulhellomananaighahahaluzlangmatulogaggressionmestgrinsinaapiprincipalesbalik-tanawpanindangpinanoodbalangnakakapagodhanap-buhayamericanhospitaltitakakaininpulgadamauntognakahantadayawnabuhaypakisabiisinilangvocalpapaanoumulanmag