Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "dream"

1. Dedication is what separates those who dream from those who turn their dreams into reality.

2. Good. Pahinga ka na. Dream of me. aniya.

3. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

4. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

5. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

6. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

7. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

8. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

9. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

10. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

11. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

12. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

13. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. Ang pag-asa ay nagbibigay ng pag-asa sa mga taong mayroong mga pangarap at mga layunin sa buhay.

3. Nagtanim ng puno ang mga boluntaryo nang limahan.

4. Magkano ang halaga ng bawat isang blusa?

5. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

6. Gaano ko kadalas dapat inumin ang gamot?

7. Christmas is observed by Christians around the world, with various customs and traditions associated with the holiday.

8. "A house is not a home without a dog."

9. Patients may be discharged from the hospital once their condition has improved, or they may need to be transferred to another healthcare facility for further treatment.

10. A bird in the hand is worth two in the bush

11. Oscilloscopes are useful for troubleshooting electronic circuits, identifying faults, and verifying signal integrity.

12. Las labradoras son muy activas y necesitan mucho ejercicio diario.

13. Folk med en historie af afhængighed eller mentale sundhedsproblemer kan være mere tilbøjelige til at udvikle en gamblingafhængighed.

14. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

15. Bakit mo siya binilhan ng kurbata?

16. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

17. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

18. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

19. Instagram has become a platform for influencers and content creators to share their work and build a following.

20. The French omelette is a classic version known for its smooth and silky texture.

21. Napakagaling nyang mag drowing.

22. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

23. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

24. The movie was absolutely captivating from beginning to end.

25. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

26. Football has a rich history and cultural significance, with many traditions and customs associated with the sport.

27. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

28. I don't have time for you to beat around the bush. Just give me the facts.

29. Trump's immigration policies, such as the travel ban on several predominantly Muslim countries, sparked significant debate and legal challenges.

30. Gusto kong mag-order ng pagkain.

31. Tumama ang kanan niyang pisngi sa labi ng nabiawang balde.

32. He is having a conversation with his friend.

33. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

34. Det er vigtigt at have en kompetent og erfaren jordemoder eller læge til stede under fødslen.

35. Hoy en día, el internet es una parte integral de la vida cotidiana.

36. Bias and ethical considerations are also important factors to consider when developing and deploying AI algorithms.

37. Lazada has a reputation for offering competitive prices and discounts.

38. Dahil dito, walang may gustong makipagkaibigan sa kanya.

39. Maraming alituntunin ang ipinatutupad sa eskwelahan.

40. Hinawakan ko yung tiyan ko, Konting tiis na lang..

41. Ano ang suot ng mga estudyante?

42. Sa paghahanap ng solusyon sa mga palaisipan, mahalaga ang tamang pag-iisip, pag-aaral, at eksperimentasyon.

43. Masyado ka naman nagpapaniwala kay Andrew!

44. Lumaking masayahin si Rabona.

45. Ang kasal ay nagbibigay ng mga ala-ala at emosyon na hindi malilimutan ng mga taong kasama sa okasyon.

46. Bagaimana kondisi cuaca di sana? (What is the weather condition there?)

47. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

48. Nous avons invité tous nos amis et notre famille à notre mariage.

49. Det er vigtigt at have relevant erfaring, når man søger en ny jobposition.

50. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

Similar Words

dreams

Recent Searches

dreampunsoibonmorenatapatniluloncountriesenchanteddinibranchesinissumaladontmamihierbascorrectingmonetizingactioncouldnasundopinilingformatiposmarkhaliksinapoknakakakuhamuchaskabinataannapatungohverautomaticanlabolearningleadlibrogitanasimprovedqualitynagkalatdadauposupremenakihalubilowidelymuligtmag-aamakwebangbumibilibesttodobumigayseasonpagtitiponlibrengk-dramaexperts,guidanceellenmagkapatiddumadatingpatrickpinaulanannaupofiautilizanbibisitanag-umpisadumatingsimbahaisinalangouecreativepag-ibigkitang-kitaipantalopipagpalitinisa-isatanimriseneromagtakamagka-babykapangyarihanglabinghitagracereducedcontestbestfriendturismotungkodgawingtaon-taonmadurassoonpulgadaproperlypopularizepoliticspinakamaartengpagkaawanangingisaynakapagngangalitkarangalannahigitankagabimarinignagbabalaahhlumilingonakmangestasyonentertainmentdebatesborn4thxviipamilihantanawskyldes,nayonnagpapasasamisamaputikonsultasyonnakaangatpeppynaglulutoculturabroughtmaratingpaglulutonakalagaymatangumpaykulisappagkuwangapmapaikotfascinatingumanocrameelitebisigagam-agamhabangipinikitiligtasmahalagazamboangababamahusayhinigitbugtongjunionakapasarebolusyonpumatolrimasiikotnatuwadisappointoperahaniwinasiwaskampeonregularmentenakapangasawanagtatrabahogayunpamanmataasmagtanghalianmag-asawamagpapabunotnagtrabahoisinulatnakakapasokpinagalitansaranggolakinagagalakinalokmagbabagsikinaabutanpagpapautanginferioresnagpaiyaknapasigawsunud-sunuranpaumanhinnapanoodnapakasipagpagkagisinghomeibinigaybabasahinmakabilimagsugalnalugodumikotmagsunogkuwento