Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

13 sentences found for "dream"

1. Dedication is what separates those who dream from those who turn their dreams into reality.

2. Good. Pahinga ka na. Dream of me. aniya.

3. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

4. Mi sueño es ser un artista exitoso y reconocido. (My dream is to be a successful and recognized artist.)

5. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

6. Mi sueño es tener una familia feliz y saludable. (My dream is to have a happy and healthy family.)

7. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

8. No hay nada más poderoso que un sueño respaldado por la esperanza y la acción. (There is nothing more powerful than a dream backed by hope and action.)

9. Sueño con tener la libertad financiera para hacer lo que quiero en la vida. (I dream of having financial freedom to do what I want in life.)

10. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

11. Sueño con tener un estilo de vida saludable y activo. (I dream of having a healthy and active lifestyle.)

12. Sueño con viajar por todo el mundo. (I dream of traveling around the world.)

13. Whether you are writing for personal satisfaction or to share your knowledge with others, the most important thing is to stay true to your message and to not give up on your dream of becoming a published author

Random Sentences

1. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

2. Saan nakatira si Ginoong Oue?

3. Ang hilig mong mang hiram ng gamit tapos di mo naman binabalik!

4. Ano?! Diet?! Pero tatlong plato na yan ah.

5. True forgiveness involves genuine empathy and a willingness to see the humanity and potential for change in others.

6. Pumunta si Trina sa New York sa Abril.

7. Proud ako sa kultura at tradisyon ng mga Pinoy.

8. Pumunta kami kahapon sa department store.

9. Nasaan ang Ochando, New Washington?

10. Ang pagguhit ay isang mahusay na paraan upang ipakita ang iyong kreatibidad.

11. Iwinasiwas nito ang nagniningning na pananglaw.

12. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

13. Ang sobrang pangamba ay maaaring magdulot ng kakulangan sa kumpyansa sa sarili.

14. Ang ina ay si Aling Rosa at ang anak ay si Pinang.

15. Puwede ho ba akong kumain ng baka at baboy?

16. A pesar de su mala reputación, muchas serpientes son inofensivas para los seres humanos y desempeñan un papel crucial en la naturaleza.

17. Eine klare Gewissensentscheidung kann uns helfen, uns selbst und andere besser zu verstehen.

18. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

19. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

20. Malaki at mabilis ang eroplano.

21. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

22. Mas masaya naman ako pag napapasaya kita eh.

23. Pagkatapos ng magandang ani, ang aming hardin ay hitik sa sariwang gulay at prutas.

24. Les personnes âgées peuvent avoir des problèmes de communication en raison de problèmes de vue ou d'ouïe.

25. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

26. Proper training and socialization are essential for a well-behaved dog.

27. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

28. Pumasok ka na lang sa kwarto. Susunod na lang ako..

29. Twinkle, twinkle, all the night.

30. Gaano katagal po ba papuntang palengke?

31. Fue inventado en 1876 por Alexander Graham Bell y desde entonces ha evolucionado para incluir un

32. Pagputi ng uwak, pag-itim ng tagak.

33. Kung ano ang puno, siya ang bunga.

34. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

35. Hindi siya makabangon at makagawa ng gawaing bahay.

36. Hendes øjne er som to diamanter. (Her eyes are like two diamonds.)

37. If you quit your job in anger, you might burn bridges with your employer and coworkers.

38. i Maico. Pagkuwan eh parang batang nagdabog siya.

39. Magkikita kami bukas ng tanghali.

40. He is taking a photography class.

41. Sebagai bagian dari perawatan pasca kelahiran, ibu disarankan untuk menghindari aktivitas fisik yang berat dan menjaga pola makan yang sehat.

42. They play video games on weekends.

43. Nasa kanan ng restawran ang sinehan.

44. Masyado siyang tulala sa kanyang pangarap at hindi na niya napapansin ang totoong mundo.

45. Fødslen kan føre til hormonelle og følelsesmæssige ændringer, så det er vigtigt at tage sig af sin mentale sundhed.

46. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

47. The LA Lakers, officially known as the Los Angeles Lakers, are a professional basketball team based in Los Angeles, California.

48. Research on viruses has led to the development of new technologies, such as CRISPR gene editing, which have the potential to revolutionize medicine and biotechnology.

49. Kailangan ko ng lumisan mahal ko.

50. The wedding ceremony is often followed by a honeymoon.

Similar Words

dreams

Recent Searches

televiewingipatuloyhusodreamavailablefacebookoncepasanexperiencespooklastotrasklimamalagohydeltodaydyanalignslockdowndaddybubongputiincreasinglydidingstudentdeleconventionaltandafinishedipasokmamingangunitmaispitongnahuhumalingsetsbituinwouldmuchuniqueallowedandrefiguresquatterformthoughtsmovinglikelymasayahinmataaspinakamahabapinalambotkatuladlabasopportunitymanghulipagtatanongkabutihannagpakitaseriouskandidatoshowsmurang-muraaraliiklitrasciendekalikasanapoyninanais1920spresidentsofagovernmentpantallascultureslabissalitanginternetkinasisindakanamendmentscosechar,deliciosapanindangreguleringnuhpresleypagkabiglaparaangcultivationandleytelumilingonsumasayawleadingpresidentialairportmalakingharapanpagkamulatmasasabidali-dalihanapindinalawanak-mahirapaabotkutolinggotigrepinaladagapinipilitkapit-bahaynakatagoabotunanilawsupilinanak-pawiskalaunanano-anomababawdrawingmatulogmagsasalitamakikitamatulunginnakakapamasyale-commerce,paglisantuktokeskuwelahannakaka-inmeretumawagnagsamapartmustplayspapayaproblemaparusatrenmagkabilangstudentsasobritishmagkapatideditornapakamisteryosomagkaroonpabigatmulti-billionbecomesumikotmeetnagbaliknagagandahanjuanitocornerspagkainismamahalinpanaymusicianilalagaynalugmokmagingdolyarkassingulangkababayanpaninigasmanilbihanknowpatiencemagsusuotalaymakahingimatutongpanalanginnaslumiwagnagreklamokasiyahanpokerbosslalabhanduwendebulateglobalisasyonurisakristanreplacedbilhinnapadaaniniwanresignationiyodedicationmasterbasahin