Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "nutrientes"

1. Aplica abono orgánico al suelo para proporcionar nutrientes adicionales a las plantas

2. El cultivo de tomates requiere un suelo bien drenado y rico en nutrientes.

3. El maíz es un cultivo exigente en nutrientes, por lo que es necesario aplicar abono regularmente

4. El maíz necesita sol y un suelo rico en nutrientes

5. Las plantas carnívoras son capaces de atrapar y digerir insectos u otros pequeños animales para obtener nutrientes adicionales.

6. Los alimentos ricos en nutrientes son fundamentales para mantener un cuerpo sano.

Random Sentences

1. Ano ang ginagawa mo nang nagkasunog?

2. Maglalaro nang maglalaro.

3. Siguro nga isa lang akong rebound.

4. They are not hiking in the mountains today.

5. I reached my credit limit on the card and couldn't make any more purchases.

6. Sa mga dagok ni ogor, tila nasasalinan pa siya ng lakas.

7. Investing in the stock market can be a form of passive income and a way to grow wealth over time.

8. Basta may tutubuin ako, lahat ay areglado.

9. Congress is divided into two chambers: the Senate and the House of Representatives

10. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

11. Ang laki ng bahay nila Michael.

12. Cigarettes made of tobacco rolled in tissue paper helped spread a very harmful habit among the so-called advanced countries of the West

13. Halos gawin na siyang prinsesa ng mga ito.

14. Bibigyan ko ng cake si Roselle.

15. Sasambulat na ang nakabibinging tawanan.

16. Este plato tiene un toque picante que lo hace especial.

17. Isang matandang lalaki naman ang tumikim sa bunga.

18. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

19. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

20. The love that a mother has for her child is immeasurable.

21. The Hollywood Bowl is an iconic outdoor amphitheater that hosts concerts and live performances.

22. The grocery store offers a variety of fresh produce, including fruits and vegetables.

23. Das Gewissen kann uns helfen, die Folgen unserer Handlungen besser zu verstehen.

24. Omelettes can be seasoned with salt, pepper, and other spices according to taste.

25. Tengo dolor de garganta. (I have a sore throat.)

26. Bunso si Bereti at paborito ng ama.

27. La science de la météorologie étudie les phénomènes météorologiques et climatiques.

28. Hiramin mo ang aking payong dahil umuulan ng malakas.

29. Les personnes âgées peuvent avoir des relations intergénérationnelles enrichissantes avec leurs petits-enfants.

30. Kumakain ng tanghalian sa restawran

31. Kailangan ng maraming niyog upang makagawa ng malaking tasa ng pulotgata.

32. The foundation's charitable efforts have improved the lives of many underprivileged children.

33.

34. Oo malungkot din ako. Mamimiss kita.

35. Supporting policies that promote environmental protection can help create a more sustainable future.

36. He has traveled to many countries.

37. Some sweet foods have cultural and religious significance, such as honey in Jewish traditions and dates in Muslim traditions.

38. Wag ka naman ganyan. Jacky---

39. Gusto ko lang ng kaunting pagkain.

40. The park has a variety of trails, suitable for different levels of hikers.

41. Mahalaga na maging bukas ako sa mga taong maaaring makatulong sa akin upang maalis ang aking mga agam-agam.

42. In the early days, telephones were connected to a central switchboard, which connected calls manually

43.

44. Ang mommy ko ay masipag.

45. Mathematics has many practical applications, such as in finance, engineering, and computer science.

46. Es común usar ropa abrigada, como abrigos, bufandas y guantes, en invierno.

47. Exercise can be tough, but remember: no pain, no gain.

48. Natutuwa ako sa magandang balita.

49. The momentum of the athlete propelled him across the finish line.

50. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

Similar Words

nutrientes,

Recent Searches

stonehamnutrientescleannagaganapdaigdigcomplexpaangibinalitangnagsabaybalingdireksyonyakapconvertidaslumipadpalamag-usapmagta-trabahomakabalikbiocombustiblesnagmakaawamakapangyarihangpagpapatubopare-parehomagkakailanagkakakainkinatatalungkuangnagsisipag-uwianitinindigpunongkahoymagbabakasyonnangahaspagkuwaculturehilingwalongnagsineumiiyaknakuhangnagsagawapinakamahabapaghihingalomusiciannamulattinaasanpagngitinakakabangonpagsumamomagigitingbilangbawamataliknagpabotcourtparehongpaumanhinflyvemaskinermakahihigitkalayuanmagpapagupitnagmadalingutak-biyaiintayingirlselebrasyonmatustusankinakawitannapahinganeedlessmalakasmuchosedit:palibhasagumawalumamanglabinsiyamnakahugkagipitangandahaniloilonapakahabapacienciadumalawkumakantasmallihahatidobstaclescassandramangyarimagkanodiyaneskuwelapaglulutoenviartumikimnearnatuwamakauwipasyenteintensidadilalagaypagkakataonumuwikangitanpagbisitasusunodlansanganmismosinonagyayangdiferentesorkidyasfulfillmentnatutulogkakilalanaglutonagbagoimprovementbonifacioexperience,pitakafiancekindergartenwakasvegasnapabiglaanpigainbunutankainanparusahanliligawanumokaysuriintumibayfitoperativoskastilaricoelenamaghahandangipingkaraniwangmagdaangownthereforebumuhossayawanalagaturonhumigaheartbreakasiaticanihinmatarayparehasmaayosbestidaganidnagisingbinibilangmartialinfluencesmakapangyarihanparaan1990restawandeclareipinadalacitizensfiverrgabrielmataposparinzoomeronbinatakbilibnuhthankcarbondibalifepatuloypisocelulareslendinggabingibondalawasumagotbestlalapalayasolikesactionnagandahanbutchtandanababakas