Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "come"

1. "Dogs come into our lives to teach us about love and loyalty."

2. All these years, I have been grateful for the opportunities that have come my way.

3. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

4. Come on, spill the beans! What did you find out?

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good things come to those who wait

7. Good things come to those who wait.

8. It is brewed from roasted coffee beans, which come from the Coffea plant.

9. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

10. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

11. Maaf, saya tidak bisa datang. - Sorry, I can't come.

12. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The store was closed, and therefore we had to come back later.

15. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Hindi niya alam kung paano niya haharapin ang buhay na nag-iisa.

2. Soto ayam adalah sup ayam yang dimasak dengan rempah-rempah Indonesia khas.

3. Ang carbon dioxide ay ina-absorve ng mga puno.

4. Trump's handling of the COVID-19 pandemic drew both praise and criticism, with policies like Operation Warp Speed aiming to accelerate vaccine development.

5. Cheating can be caused by various factors, including boredom, lack of intimacy, or a desire for novelty or excitement.

6. Algunas personas disfrutan creando música electrónica y mezclando sonidos para crear nuevas canciones.

7. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

8. Unti-unti na siyang nanghihina.

9. Walang mangyayari satin kung hindi tayo kikilos.

10. Nagsmile si Athena tapos nag bow sa kanila.

11. The elderly are at a higher risk of developing pneumonia.

12. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

13. She began her career in musical theater and appeared in the Broadway production 13 in 2008.

14. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

15. The presentation was absolutely flawless; you did a great job.

16. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

17. Cancer can be prevented through healthy lifestyle choices, such as regular exercise, a balanced diet, and avoiding tobacco and excessive alcohol consumption.

18. Erfaring har lært mig, at kommunikation er nøglen til en vellykket virksomhed.

19. Naghihirap na ang mga tao.

20. Pinagpatuloy ko na ang pagkain ko.

21. Hindi maiiwasang magkaroon ng mga biktima sa digmaan, kasama na ang mga sibilyan.

22. He was selected as the number one overall pick in the 2003 NBA Draft by the Cleveland Cavaliers.

23. Naku! Hindi pede, hindi akin yan eh. eh kay Chad yun eh.

24. Aray! nagcurve ball sya sa sakit sa sahig.

25. The invention of the telephone and the internet has revolutionized the way people communicate with each other

26.

27. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

28. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

29. Players move the ball by dribbling, passing, or shooting it towards the basket.

30. Nakuha ko ang aking dream job kaya masayang-masaya ako ngayon.

31. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

32. Waring may bumisita sa bahay kagabi dahil bukas ang pintuan sa umaga.

33. The early bird catches the worm.

34. Ang bango ng lupa pagkatapos ng ulan ay nagdala ng mabango at sariwang simoy.

35. She admires the philanthropy work of the famous billionaire.

36. Algunas heridas, como las provocadas por mordeduras de animales, pueden requerir de vacunación antirrábica o tratamiento contra el tétanos.

37. Pero bigla na lang siyang hindi nagpakita.

38. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

39. Dapat pinakamasaya ang Sabadong ito sa lahat ng Sabado.

40. Babayaran kita sa susunod na linggo.

41. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

42. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

43. Regular grooming, such as brushing and bathing, is important for a dog's hygiene.

44. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

45. Bigla nya akong hinigit sa kwelyo, Anong sinabi mo?

46. You can't judge a book by its cover.

47. Me siento cansado/a. (I feel tired.)

48. Samantala sa pagtutok sa kanyang mga pangarap, hindi siya nagpapatinag sa mga hamon ng buhay.

49. Puwede bang makausap si Clara?

50. Sige na, sabihin mo na yung mga gusto mong sabihin sa akin.

Similar Words

becomesbecomeincome

Recent Searches

cometheirkumarimotbrucemuchosconsideredtangkapaulit-ulithumanostangomalimutanginagawabringing2001islabulasingercandidateworkdaypressfaultsagingbetainterviewingmenuinteligentesscalehapasinnuts1982beforepag-akyatrelowordnapilingprogrammingshiftcontinueactordoingelectinfinitycallingculturalfollowinginventadopinagmamalakiginugunitaedit:oscarbatipaaralanmag-plantnananaghilialasngunitkaninumanhuliaanhinpronountatagaljuegosbibigkinalakihanpaghalikpopcornkahithawaiitumalonprutaspabulongmasaganangilocosnamindraybertuwafilmtuklasbayadpagdiriwangmonumentotiningnanhinalungkatrestawranjocelyniikliresumenbranchnilangyeahgobernadorpalipat-lipatnabuhaymakapangyarihangnapakatagalpagka-maktolpinakamagalingnakatunghayespecializadasnamulatnaghihirapmagdamaganmagturonaiilangmagtigilna-fundnaglokosasakyannapaiyakmiramatalinonagsasagotmangangahoynagsunuranpagkuwakarwahengpulgadapagdudugolumamangpagtawamagpapagupitdoble-karatitamakuhasang-ayonnapansinnaiiritangnatinagpagkaawamagtatanimisinagotdiyaryominatamisparusahanrewardingtulisantrentaafternoonnaglarotiyaknalangminerviekapwamaya-mayamaaksidentebinawianmasungitbutterflymakakatiniklinginventionkamotenagplaymandirigmanghinahaplosduwendenapasukobunutanbobotoinspiremaatimmaghintaybulongasiamusiciansreynaanatinapaylunespalakatagaroonsalbahenanaybumilishipbalotdefinitivobecamebinanggasusiumalisincidencenetflixanywhereangkanparkingsumagotlandeparkeipinasyangscottishhaybotantekrussoccermournedparihinigitpasigawilog