Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "come"

1. "Dogs come into our lives to teach us about love and loyalty."

2. All these years, I have been grateful for the opportunities that have come my way.

3. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

4. Come on, spill the beans! What did you find out?

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good things come to those who wait

7. Good things come to those who wait.

8. It is brewed from roasted coffee beans, which come from the Coffea plant.

9. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

10. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

11. Maaf, saya tidak bisa datang. - Sorry, I can't come.

12. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The store was closed, and therefore we had to come back later.

15. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Hindi dapat pagbasehan ang pagkatao ng isang tao sa kababawang mga bagay tulad ng panlabas na anyo.

2. Ang mga bayani noon ay nangahas na ipaglaban ang kalayaan kahit na kapalit nito ang kanilang buhay.

3. Ang mga mamamayan sa mga lugar na mayaman sa tubig-ulan ay dapat mag-ingat sa pagtatapon ng basura upang maiwasan ang pagbabara ng mga daluyan ng tubig.

4. Waring nag-aalinlangan siyang sagutin ang tanong ng guro.

5. Bilang paglilinaw, ang pagsasanay ay para sa lahat ng empleyado, hindi lang sa bagong hire.

6. Mahalagang magbigay ng respeto sa bawat isa, samakatuwid.

7. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

8. Ultimately, a father is an important figure in a child's life, providing love, support, and guidance as they grow and develop into adulthood.

9. Pahiram ng iyong cellphone, nawala ang aking battery.

10. Have you eaten breakfast yet?

11. Anong buwan ang Chinese New Year?

12. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

13. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

14. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

15. The website's search function is very effective, making it easy to find the information you need.

16. Araw araw niyang dinadasal ito.

17. Sa tingin ko ay hindi ito magiging epektibo kaya ako ay tumututol sa kanilang desisyon.

18. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

19. Pero gusto ko nang umuwi at magpahinga.

20. Gusto kong tumakbo at maglaro sa parke.

21. La tos puede ser un síntoma de COVID-19.

22. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

23. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

24. Bumibili si Consuelo ng T-shirt.

25. Digital oscilloscopes convert the analog signal to a digital format for display and analysis.

26. Me encanta la comida picante.

27. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

28. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

29. "Ang kabataan ang pag-asa ng bayan," ani ni Jose Rizal.

30. Kapatid mo ba si Kano? isasabad ng isa sa mga nasa gripo.

31. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

32. You're stronger than this, pull yourself together and fight through the tough times.

33. Su obra también incluye frescos en la Biblioteca Laurenciana en Florencia.

34. Ang agam-agam ay maaaring maging hadlang sa pagpapasiya at pagkilos ng tao.

35. Claro que te apoyo en tu decisión, confío en ti.

36. Hulk is a massive green brute with immense strength, increasing his power the angrier he gets.

37. Omelettes are a popular choice for those following a low-carb or high-protein diet.

38. Da Vinci fue un pintor, escultor, arquitecto e inventor muy famoso.

39. Mi amigo y yo nos conocimos en el trabajo y ahora somos inseparables.

40. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

41. Magsusunuran nang manukso ang iba pang agwador.

42. Napakamisteryoso ng kalawakan.

43. Ang mga pasahero ay nagbigay ng kanilang mga mungkahi upang mapabuti ang karanasan sa paglalakbay.

44. Cutting corners on food safety regulations can put people's health at risk.

45. Nakakapagod pala umakyat ng bundok.

46. Pangit ang view ng hotel room namin.

47. Ang kalangitan ay nagbabaga sa pulang liwanag ng dapithapon.

48. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

49. Nagpaabot ako ng bulaklak sa kanyang bahay upang ipakita ang aking pagmamahal sa nililigawan ko.

50. Sleeping Beauty is a princess cursed to sleep for a hundred years until true love's kiss awakens her.

Similar Words

becomesbecomeincome

Recent Searches

comemalimityantekstarabiapowersdarkbadingordernothingalebubongpollutioneksenainsteadgitaraulinginformedkasingrefthingreleasednotebookimbesnotdamitpumilimagagawakumidlatbowlibinibigaymagdoorbellguitarranasasalinanmaghihintayskyldes,empresassalaminmarahilconclusion,caraballonakatuongjortcashnangyarilumilingonmakulituniversalgranadabinulongmaskaracinesigecomienzanreadershomework10thmakilingmatindingryanworkshopventadotapagkalitopotaenapinag-usapangeologi,masayang-masayangtumutubohitikleadpatuloymagbibiyahemusicianmagpaniwalanagmungkahiespecializadasnakaluhodnaglalatanglinggongnandayamagpalagopioneerpangangatawanpaki-chargeleksiyondiretsahanghitanagkalapithouseholdstungawhiwaculturalnagpalalimkarwahengfranciscosinisiranakatitigdiinkolehiyokinumutanmagbaliknapalitangpag-aaralpalantandaanvanmagselosika-50amuyinnatitiyaktinuturobinentahankatolisismocruzfollowednagsimulamasungitawitantiniklingmagalitjeepneypigilanvelfungerendegusting-gustoisubobibilhinkaninamandirigmangtirangpaakyatnakatinginisinumpatondobuwayaamendmentskamotenagdaossumasaliwbigasmapaibabawisinasamaexpresanmakinanghangintuladganitoupuangigisingilagaybalotpuwedepagputidefinitivomissionvivabagkuswikachoosegoalpaskongdikyammaibalikjenakinantashinesmaisdreamnagbasalegislationbingiparimejomemberssumabogownbernardosabihingokayaywantoothbrushguhitpiecesdesdecoaching:sumarapmaaringtanimrestawanpitakabatiprivateleedragonfansjeromeminutelegislativecompartenkiloadd