Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "come"

1. "Dogs come into our lives to teach us about love and loyalty."

2. All these years, I have been grateful for the opportunities that have come my way.

3. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

4. Come on, spill the beans! What did you find out?

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good things come to those who wait

7. Good things come to those who wait.

8. It is brewed from roasted coffee beans, which come from the Coffea plant.

9. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

10. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

11. Maaf, saya tidak bisa datang. - Sorry, I can't come.

12. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The store was closed, and therefore we had to come back later.

15. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Pagkakataon na ni Ogor upang sumahod.

2. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

3. Arbejdsgivere tilbyder ofte sociale fordele som sygesikring og betalt ferie.

4. Sa ganang iyo, dapat pa bang bigyan ng pangalawang pagkakataon ang mga nagkasala?

5. Malaki at mabilis ang eroplano.

6. In conclusion, the telephone is one of the most important inventions in human history

7. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

8. Occupational safety and health regulations are in place to protect workers from physical harm in the workplace.

9. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

10. Don't beat around the bush with me. I know what you're trying to say.

11. Nanghiram ako ng bicycle para sa isang bike race.

12. Sa kanyang paglalakad sa kahabaan ng dagat, napadungaw siya sa malalaking alon at namangha sa kanilang ganda.

13. Mahirap ang walang hanapbuhay.

14. Les maladies chroniques sont souvent liées à des facteurs de risque tels que l'âge, le sexe et l'histoire familiale.

15. Las heridas pueden ser causadas por cortes, abrasiones o quemaduras.

16. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

17. Matayog ang pangarap ni Juan.

18. Si Maria ay nagpapahiram ng kanyang mga damit sa kanyang mga kaibigan.

19. Iwinasiwas nito ang nagniningning na pananglaw.

20. Bawal magpakalat ng mga pornograpikong materyal dahil ito ay labag sa batas.

21. Ang pag-iwas sa mga diskusyon at pagtatangkang itago ang mga katotohanan ay nagpapahiwatig ng pagiging bulag sa katotohanan.

22. The tech industry is full of people who are obsessed with new gadgets and software - birds of the same feather flock together!

23. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

24. Kailan itinatag ang unibersidad mo?

25. Mi amigo me prestó dinero cuando lo necesitaba y siempre le estaré agradecido.

26. Ano ang gustong palitan ng Monsignor?

27. Makapal ang tila buhok sa balat nito.

28. Pinasalamatan nya ang kanyang mga naging guro.

29. Kumain na ako pero gutom pa rin ako.

30. Ang linaw ng tubig sa dagat.

31. Hinanap ko ang pulotgata sa bukid upang magkaroon ng panghimagas.

32. Aling hayop ang nasa tabi ng puno?

33. Ako si Minervie! Ang dyosa ng dagat! Dahil sa kasamaan mo, parurusahan kita! Simula ngayon, hindi ka na maglalakad sa lupa

34. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

35. Viruses can have a significant impact on global economies and healthcare systems, as seen with the COVID-19 pandemic.

36. Twinkle, twinkle, little star.

37. La creatividad puede ayudar a solucionar problemas de manera más efectiva.

38. The sunset view from the beach was absolutely breathtaking.

39. He is painting a picture.

40. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

41. Ang mga magsasaka sa aming probinsya ay pinagsisikapan na mapanatili ang masaganang ani sa kanilang mga bukirin.

42. Sabi mo eh! Sige balik na ako dun.

43. Anong nakakatawa? sabay naming tinanong ni Sara

44. Edukasyon ay paghusayan upang malayo sa kahirapan.

45. Nasa tuktok ng gusali, natatanaw ko ang malalayong lugar na sakop ng lungsod.

46. Dumalaw si Ana noong isang buwan.

47. Hindi dapat matakot sa mailap na mga pagsubok dahil ito ay makakapagbigay ng magandang aral.

48. Dogs can be trained for a variety of tasks, such as therapy and service animals.

49. I am absolutely determined to achieve my goals.

50. Women have made significant strides in breaking through glass ceilings in various industries and professions.

Similar Words

becomesbecomeincome

Recent Searches

pagbatiyoungkumarimotcomemakapilingcomputerprogramapierbabaingmasukolmitigatewithouttoolulingallowswaitmaratinghalosskillevolveimpactedeffektivganapanipantalonpalibhasatutungomagasinnakalipaskontingmasayang-masayangkahilinganrenaiamagtagodyosatalinobarrocokasamangaalispinapasayamobilepalangaktibistanamanghaniyogpakealamnagtitiisdawmabangoipinalutokagayakumbentomulighedkusinatomlumilingonadangkaninapicssuedenandunteampositibonamulatshopeebilhanginaganoonsarilimagbubukidnegrosunibersidadundeniablepassivepag-unladmagsasalitaflaviorawnakatulogjigsdealaustraliayamanrosalumipasmahihirapquarantineamountmakatiagadramdamnasasakupanmakakasahodpageantmaghapongfacebooknewsdonesabihinumiilingvaccinesnamulaklakginugunitaisipanikinasasabikkatandaanpanghihiyangnilolokonakalagaynaninirahanmagkakailamabagalkaklaseumokayunidosminatamistuwangsumindisapatosdangerousmapapulongnagtatakbosumisideducativaspusawikaumiyaklaamangmayabangsandalinagisingbayadnapakahangapropesorbeyondbinanggamakaiponkabutihantagaytaysumakitinstrumentalflyvemaskinerinventionmatagpuanlarongmatarayingatanpalantandaancableemphasizedexplainpinagtabuyannyedadasmallanak-mahiraptokyodeliciosabedsbarung-barongitinulosrosellemauntoglearningfacilitatingnakakatulonglabastotoongsidolearnkapit-bahaygrocerynagplaykatibayangdalawangleftagamalalimnagtatampopanguloganitoayonnaminkulunganpagkalikodgawinnag-iisangkalalarooliviakomunidadbatosalamatnagbibirogasolinagrupomagbigaynanayaraw-arawpiling