Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "come"

1. "Dogs come into our lives to teach us about love and loyalty."

2. All these years, I have been grateful for the opportunities that have come my way.

3. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

4. Come on, spill the beans! What did you find out?

5. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

6. Good things come to those who wait

7. Good things come to those who wait.

8. It is brewed from roasted coffee beans, which come from the Coffea plant.

9. La esperanza nos ayuda a superar los obstáculos y desafíos que se presentan en nuestro camino. (Hope helps us overcome the obstacles and challenges that come our way.)

10. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

11. Maaf, saya tidak bisa datang. - Sorry, I can't come.

12. Oscilloscopes come in various types, including analog oscilloscopes and digital oscilloscopes.

13. The elephant in the room is that the company is losing money, and we need to come up with a solution.

14. The store was closed, and therefore we had to come back later.

15. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Su obra más famosa es la escultura del David en Florencia.

2. Makikita ko si Mrs. Santos bukas.

3. Samvittigheden kan være en påmindelse om vores personlige værdier og moralske standarder.

4. Hindi ako sang-ayon sa pagdami ng mga krimen sa ating lipunan.

5. The doctor prescribed antibiotics to treat the pneumonia.

6. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

7. The objective of football is to score goals by kicking the ball into the opposing team's net.

8. Ang guro ko sa Ingles ay nagturo sa amin ng iba't ibang uri ng pangungusap.

9. Libro ko ang kulay itim na libro.

10. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

11. Musk's innovations have transformed industries such as aerospace, automotive, and transportation.

12. Upang huwag nang lumaki ang gulo ay tumahimik na lang si Busyang, nagpatuloy naman sa pakikipagtagpo sa mayamang Don Segundo ang ambisyosang anak.

13. The victim was relieved to finally have closure after the culprit behind the crime was caught and prosecuted.

14. Hinugot niya ang kanyang cellphone sa loob ng kanyang bulsa upang masilip ang oras.

15. The culprit behind the product recall was found to be a manufacturing defect.

16. You need to pull yourself together and face the reality of the situation.

17. Palibhasa ay magaling sa paglutas ng mga problema dahil sa kanyang mga analytical skills.

18. He is taking a photography class.

19. Tesla is also involved in the development and production of renewable energy solutions, such as solar panels and energy storage systems.

20. Las vacaciones de invierno son un momento para descansar y pasar tiempo en familia.

21. Nakarating kami sa airport nang maaga.

22. Nanalo siya ng Palanca Award para sa panitikan

23. Hindi ko alam kung may pag-asa ako sa iyo, pero sana pwede ba kitang mahalin?

24. Gusto ko ang malamig na panahon.

25. Naglipana ang mga bulaklak sa hardin dahil sa maayos na pag-aalaga.

26. Maaf, saya tidak bisa datang. - Sorry, I can't come.

27. Les riches dépensent souvent leur argent de manière extravagante.

28. Cheating can occur in many forms, including physical infidelity, emotional infidelity, or both.

29. She has been baking cookies all day.

30. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

31. Binigyang diin niya ang pagpapasakit ng Anak ng Diyos.

32. Akma siyang tatayo upang humingi ng tulong ng bigla siyang nalugmok sa kanyang kinauupuan.

33. Hun blev nødt til at skynde sig, fordi hun havde glemt sin pung på kontoret. (She had to hurry because she had forgotten her wallet at the office.)

34. Baby fever can impact relationships, as partners may have different timelines or desires regarding starting a family.

35. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

36. Arbejdsgivere leder ofte efter erfarne medarbejdere.

37. Sa pamamagitan ng isip ay pinaglagablab ni Tarcila ang barko ng mga pirata.

38. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

39. Representatives are individuals chosen or elected to act on behalf of a larger group or constituency.

40. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

41. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

42. Påsketiden er en mulighed for at tilbringe tid sammen med familie og venner og nyde det forårsagtige vejr.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Tuwing sabado ay pumupunta si Nicolas sa palasyo para dalawin si Helena.

45. Sumimangot ako at humarap ulit sa labas.

46. The invention of the telephone led to the creation of the first radio dramas and comedies

47. Naging biktima ng agaw-buhay na pagnanakaw ang kanyang pamilya.

48. Las hojas del libro están todas marcadas con notas adhesivas.

49. Aba! Bakit naman kita ililibre aber?!

50. In some cultures, the role of a wife is seen as subservient to her husband, but this is increasingly changing in modern times.

Similar Words

becomesbecomeincome

Recent Searches

comepagbatimaglakadsynligemaluwagmag-aralparisukatkinakalayaanwatawatnamingpasasalamatkakutismamasyalstreetligayainvolvebopolsanywheresearchunti-untigagganaptahimikdatividenskabkesomagkababatanasanrizalgawainnapawidilawhampaslupapagguhitamerikamungkahinatutulogmatipunokauripagkalungkotmaramingagesbringpulisdadalawinhinugotaga-agabahayshowsikukumparasoresobrananghihinakagustuhangdinalawmasakithatingmataaspamanlibreisaacmaaksidentematanggapgagambaambapigingmasaholluzsagasaanmedikalpaggitgitdiinahasminamadaligalakhinigitlayawkasalveryfluiditykakainiceinatakebumibiliipagtimplamapapaglapastangankungkaysawsawanduloextremistkinausapkailanganstrengthgandasinunggabanchooseabutankaraokenamulatbakithitikmatamiskargaipinagbilingpagtatanghalscientistenergy-coalubopumuntatutoringautomationmayahiwagamayamanSalatipinambilimamanhikanothers,napagculturespinaliguanmamahalinemailnatuwamalamangdamisulokBumababaPintokaramdamanbilangopdeltguestspoonpunopagigingnangagsibilikanasportsmayabangmathpangarapbingbingayonnagkalapitbisitasinumannakatuklawnahihilotapostulisanbestidopaghihingaloumaasanatakotnakonsiyensyanapahintomusmosbumangongamitmahalindadalhinpagkainmakinangvideosnagwaginag-away-awaynaulinigannagbibigayisinawakdinukotkara-karakamarahanupangadditionallynagdadasalrebolusyoncollectionsimaginationnamanghasuspalibhasalolonagisinglamesadiapermakapalsalubongfridaypublishingmatabangnaglalaronagsimulabagamatstatusalas-tressmga