Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "1000"

1. A picture is worth 1000 words

2. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. Les enseignants doivent collaborer avec les parents et les autres professionnels de l'éducation pour assurer la réussite des élèves.

2. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

3. Ang kakahuyan sa bundok ay mayabong at puno ng iba't ibang mga uri ng mga halaman.

4. Hun har ingen idé om, hvor forelsket jeg er i hende. (She has no idea how in love I am with her.)

5. Madamot ang matanda tuwing may pupunta sa kanyang tahanan upang humingi ng tulong, agad niyang pinalalayas ang mga ito.

6. The scientific community is constantly seeking to expand our understanding of the universe.

7. Si Hidilyn Diaz ay nag-ensayo sa Malaysia bago sumabak sa Tokyo Olympics.

8. Aling lugar sa lungsod mo ang matao?

9. The company suffered from the actions of a culprit who leaked confidential information.

10. Tak kenal maka tak sayang.

11. Ang kundiman ay patunay na ang musika ay isang malakas na kasangkapan sa pagpapahayag ng mga damdamin.

12. Hindi ko kayang hindi sabihin sa iyo, sana pwede ba kitang mahalin?

13. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

14. Está claro que la situación ha cambiado drásticamente.

15. Maganda ang bansang Japan.

16. La esperanza es el combustible que nos impulsa a seguir adelante cuando todo parece perdido. (Hope is the fuel that drives us forward when all seems lost.)

17. Bigyan mo naman siya ng pagkain.

18. Este año espero cosechar una buena cantidad de tomates de mi huerto.

19. Nagtataka ako kung bakit hindi mo pa sinasabi sa akin ang totoo.

20. Dumaan ka kay Taba mamayang pag-uwi mo, narinig niyang bilin ng ina.

21. My daughter is in her school play tonight - I told her to break a leg.

22. Opo. Ano pong kulay ang gusto ninyo?

23. Users can like, react, or share posts on Facebook to show their engagement and support.

24. The invention of the motion picture camera and the development of television and video games have provided new forms of entertainment for people of all ages

25. Ang laki ng gagamba.

26. Congress is divided into two chambers: the Senate and the House of Representatives

27. Think about what message you want to convey, who your target audience is, and what makes your book unique

28. Dumating siya mula sa Bikol kahapon ng umaga.

29. La tos crónica dura más de ocho semanas y puede ser causada por una variedad de factores.

30. At pagkauwiy humiga nang humiga at paulit-ulit na tumingin sa kawalan.

31. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

32. Confocal microscopes use laser technology to create 3D images of small structures.

33. Subalit ang mapayapa at matiwasay na pamumuhay ng mga taga-nayon ay biglang binulabog ng masasamang-loob.

34. La tos puede ser causada por una variedad de factores, incluyendo alergias, infecciones y enfermedades pulmonares.

35. Mathematics can be used to analyze data and make informed decisions.

36. Pasensya ka na anak, ang lahat ng ginagawa namin ng iyong ama ay para sa iyo.

37. Es importante no cosechar demasiado temprano, ya que las frutas aún pueden no estar maduras.

38. This could be physical products that you source and ship yourself, or digital products like e-books or courses

39. Fraud and scams related to money are a common problem, and consumers should be aware of potential risks and take steps to protect themselves.

40. Ang pagtulog ay mahalaga para sa kalusugan at kagalingan ng isang tao.

41. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

42. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

43. The basketball court is divided into two halves, with each team playing offense and defense alternately.

44. Les médicaments peuvent aider à traiter de nombreuses maladies, mais doivent être utilisés avec précaution.

45. Nakakapagpatibay ng buto ang calcium.

46. La realidad puede ser sorprendente y hermosa al mismo tiempo.

47. Hinintay kong magsalita si Kuya Patrick sa kabilang linya.

48. Baro't saya ang isusuot ni Lily.

49. It has brought many benefits, such as improved communication, transportation, and medicine, but it has also raised concerns about its effects on society

50. Hindi dapat umasa sa mailap na mga pangako ng ibang tao.

Recent Searches

1000inomsuccessattentiontinanggapubod11pmpangalanditobataymabilisbarnesdalawibigsakinmariosteveolivianananaghiliamongpasyalarryyessobrapagbahinglumakistuffedjohnhapasinumilingnuclearnerostatussulingantutorialsentercircleincreasesgapbituinpananakopnagmungkahibritishkasiyahangnaglulutogantingnagsagawavariedadevenstorebumilishunimapayapasaradonamumuongkinalimutanconstitutionordernapakasabadongngumingisicuriousawitnagtatanimnasagutanpermitenanagbakantedialledsalitangfiverrusakumantareviewthereforeeducationgiverbinatalabingtumangohinigitpasaheronagawangiconsmarkedmovingpootcompartenalilainwebsitedraft,unangmagsungitlikastitajudicialmagkaparehokinauupuangressourcernekumakalansingbaranggaypaki-translatemakapangyarihangmanamis-namisjanefeedbackbaku-bakongbotoomelettegeologi,kawili-wilimagkikitanakakapamasyalnakapagngangalitkalalakihannagbabasatinutoppaglisanpinuntahanpaki-drawingkuwadernonakakariniguugud-ugodtumutubonakatagopagtutolumiimikgusgusingmangingisdanagliwanagnakangisiiintayinmagbayadnagandahankinikilalanginirapanmakapagsabikumaliwakalakiinjurymasaksihanfilipinamaliwanaglalakadnalalabinglandlinemakikiligoninatiboknataposmanahimikmanirahanlalabaslabinsiyamengkantadangmagbibiladincluirsistemasuulamininiindamatanggapnakilaladiyaryoregulering,pundidodropshipping,inuulamnag-emailumigtadtaosbawaltumingalamabagalhayopkuligligrespektivesumasayawnakauslingipinauutanginiresetanationalconclusion,barcelonamusicalasukalmaynilatuyohinilapagbatidisensyokainanbanlagalaganapadpadteachingsendvidererightsmetodiskengkantadaydelser