Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "rough"

1. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

2. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

3. Write a rough draft: Once you have a clear idea of what you want to say, it's time to start writing

Random Sentences

1. Ketika menghadapi tantangan hidup, penting untuk menjaga keseimbangan antara kerja keras dan istirahat yang cukup.

2. La lavanda es una hierba que se utiliza en aromaterapia debido a su efecto relajante.

3. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

4. Besides, smoking cigarettes means a waste of money, since the habit instead of doing any good only causes injury to one’s health and makes one a slave to the addiction

5. Si Marian ay isang sikat na artista sa Pilipinas.

6. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

7. Les personnes âgées peuvent continuer à poursuivre des activités et des hobbies qu'elles aiment.

8. They clean the house on weekends.

9. He plays chess with his friends.

10. The dedication of mentors and role models can positively influence and shape the lives of others.

11. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

12. Ang batang matuto, sana sa matanda nagmula.

13. Hindi mapigilan ang panaghoy ng binata nang mabasa ang liham ng kanyang mahal.

14. Ang boksing ay isa mga sa sports na kinahuhumalingan ng mga Pilipino.

15. En otoño, es el momento perfecto para cosechar las aceitunas y hacer aceite de oliva.

16. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

17. Una mala conciencia puede llevarnos a tomar malas decisiones.

18. Ginamot sya ng albularyo.

19. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

20. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

21. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

22. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

23. Kailan niya kailangan ang kuwarto?

24. Tapos nag lakad na siya papunta sa may kotse.

25. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

26. Elektroniske apparater kan gøre vores liv nemmere og mere effektivt.

27. The TikTok community is known for its creativity and inclusivity, with users from all over the world sharing their content.

28. One man, one word ka ba? Ang tipid mong sumagot eh!

29. The heavy traffic on the highway delayed my trip by an hour.

30. Nous avons fait un discours lors de notre réception de mariage.

31. Ang pagpapalitan ng mga bulaklak ay karaniwang ginagawa sa kasal.

32. Umabot sa hukuman ang panaghoy ng mga biktima ng kalamidad para humingi ng hustisya.

33. Ugali mo panget! Bitawan mo nga ako! Sisipain na kita!

34. Some tips to keep in mind: Set a schedule for writing, it will help you to stay on track and make progress

35. Fundamental analysis involves analyzing a company's financial statements and operations to determine its value.

36. Nakatayo ito sa kanyang tabi at hawak na naman ang kanyang kuwaderno at lapis.

37. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

38. Nakabili na sila ng bagong bahay.

39. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

40. Elvis Presley, also known as the King of Rock and Roll, was a legendary musician, singer, and actor who rose to fame in the 1950s

41. She found her passion for makeup through TikTok, watching tutorials and learning new techniques.

42. Ang mga manggagawa nagsisilbi sa kanilang kumpanya upang magtrabaho at kumita ng pera.

43. Nakatanggap ng bola si Mark mula sa kanyang lolo bilang regalo.

44. Sa tulong ng meditasyon, mas napalalim ang aking kamalayan sa aking sarili at emosyon.

45. Kucing juga dianggap sebagai hewan yang bisa membantu mengurangi stres dan kecemasan.

46. Instagram Stories is a feature that lets users share temporary photos and videos that disappear after 24 hours.

47. Ang pagtanggi sa mga paniniwala at opinyon na hindi pabor sa sarili ay nagpapakita ng pagiging bulag sa katotohanan.

48. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

49. Di pa namin napapag-usapan yan 'My.

50. Some businesses have started using TikTok as a marketing tool to reach younger audiences.

Similar Words

throughThroughoutbrought

Recent Searches

roughmotionumarawextrapaki-chargekaibiganpumatoltiniradorlalabasatensyongnasasabihanpag-iwannakatagonagtalagapapapuntaeksport,kasamangmagkipagtagisannanlalamigkuwadernopaghaharutanfurtherpagsagotbilugangwariarbejdsstyrkepalayokasignaturaumigtadnakaakyatmagsungitpagkikitapandemyakampanauniversitiesnakapikitkahitpagtutolisipinnatakotresearch,plasaangheltasadi-kalayuananotherarawmerlindabroadcasttenersineeksenapaulafitsalatreservedspachoicetumikimstorepopularfatalshiftposterbinentahantandangmatagumpayika-12magtatakanagsilapitpagbibirosignaleksempeltinatanongmakalaglag-pantybaku-bakonghinawakannahawakannakasahodtuluyannakapaligidnamumulothitsuranasasakupantatawagmagkahawakadvertising,nagngangalangmagpa-ospitalwalkie-talkiekakuwentuhanlibokonsentrasyonpagka-maktolpaghalakhakkinikitanagbiyayanakagawianmakapangyarihangnapakatagalagricultoresnananaghilinakaririmarimnapatayonagtataasmakakakaintaun-taoninasikasopagkabuhaytatawagantumagaltiktok,nandayanaiyaknaibibigaynakatulognahihiyangnapakamotnilinisfreedomsfollowingfavormaskaramaawaingbumalikbanaltaksiumagakapwanamilipitnalagutanpagdudugomaisusuotnagkasakitnecesariolinggongtumiraartistmagbalikairportinagawjingjingmagtagosenadormagpapigilpagbabayadthanksgivingintensidadbowlpeer-to-peermarketing:kaliwausuariobutikisanggolsuzettekangkongtennissagutinhumihingipinapakinggantsonggopadalaskilaykalaromantikahabitsminerviebefolkningenakinhinahaplosincrediblehanapinbiglaanunconventionalpaakyatlakaddyosapunung-punoniyoendvideresalbahengbumilisusikatagalankasaysayanpapelkarangalannaglabananpalakamatitigasiigibnatineleksyonalleawitininnovationengkantadaperseverance,asahan