Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "matutong"

1. Baka roon matutong matakot iyan at magsabi ng totoo.

2. Gusto kong matutong tumugtog ng gitara.

Random Sentences

1. "Every dog has its day."

2. Biglaan kaming nag-decide na magbakasyon sa beach ngayong weekend.

3. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

4. En helt kan være enhver, der har en positiv indflydelse på andre mennesker.

5. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

6. Ibinigay ng mga magulang ko ang lahat ng kanilang sakripisyo upang maibigay ang magandang buhay sa amin.

7. The patient was advised to limit alcohol consumption, which can increase blood pressure and contribute to other health problems.

8. Sweetness can be addictive and overconsumption can lead to health issues, such as obesity and diabetes.

9. Kumain kana ba?

10. Kabilang na dito ang pamilya ni Mang Pedro at Aling Rosa at ang nag-iisa nilang anak na si Ana na siyam taong gulang.

11. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

12. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

13. Napuno ng mga tao ang mga lansangan, kaya't ang lungsod ay hitik sa kasiyahan sa selebrasyon ng pista.

14. Achieving fitness goals requires dedication to regular exercise and a healthy lifestyle.

15. Magalang na nagpakumbaba si John nang makita ang matanda sa kalsada at tinulungan ito.

16. Los alergenos comunes, como el polen y el polvo, pueden causar tos en personas sensibles a ellos.

17. The football field is divided into two halves, with each team playing offense and defense alternately.

18. Nagpunta ako sa Hawaii.

19. Puwede ba kitang ibili ng inumin?

20. Después de varias semanas de trabajo, finalmente pudimos cosechar todo el maíz del campo.

21. Te llamaré esta noche para saber cómo estás, cuídate mucho mientras tanto.

22. The credit check for the apartment rental revealed no red flags.

23. I can't believe how hard it's raining outside - it's really raining cats and dogs!

24. Palibhasa ay may kakayahang magpakalma sa mga sitwasyon ng kaguluhan at kalituhan.

25. Ito'y hugis-ulo ng tao at napapalibutan ng mata.

26. The backpack was designed to be lightweight for hikers, yet durable enough to withstand rough terrain.

27. The nature of work has evolved over time, with advances in technology and changes in the economy.

28. Athena.. gising na. Uuwi na tayo maya maya.

29. Chester A. Arthur, the twenty-first president of the United States, served from 1881 to 1885 and signed the Pendleton Civil Service Reform Act.

30. Sa edad na 35, si Rizal ay pinatay sa pamamagitan ng pagsasalang ng baril sa Luneta Park noong Disyembre 30, 1896.

31. I woke up to a text message with birthday wishes from my best friend.

32. Electric cars are becoming more popular due to the increasing demand for sustainable transportation options.

33. The Explore tab on Instagram showcases popular and trending content from a wide range of users.

34. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

35. En invierno, el cielo puede verse más claro y brillante debido a la menor cantidad de polvo y humedad en el aire.

36. She has a poor credit history due to late payments and defaults on loans.

37. Football requires a combination of physical and mental skills, including speed, agility, coordination, and strategic thinking.

38. Les enseignants peuvent organiser des projets de groupe pour encourager la collaboration et la créativité des élèves.

39. Let's keep things in perspective - this is just a storm in a teacup.

40. The concept of money has been around for thousands of years and has evolved over time.

41. We need to reassess the value of our acquired assets.

42. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

43. The wedding party typically includes the bride and groom, bridesmaids, groomsmen, flower girls, and ring bearers.

44. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

45. Binigyan ni Jose ng pera si Bob.

46. All these years, I have been surrounded by people who believe in me.

47.

48. Binati niya ito ng "Magandang umaga sa iyo".

49. Nangyari ang isang malaking proyekto sa aming lugar dahil sa bayanihan ng mga residente.

50. Ang paglalakad sa tabing-dagat tuwing umaga ay nagbibigay sa akin ng isang matiwasay na karanasan.

Recent Searches

malapitdaysmatutongnaritolarongbumabagmatamanmagtanghalianyataskyldes,katedralganamakakalimutinikinabubuhaykumukuhabernardogandavedvarende1787hitiknararapatforståbumuhospaggawatupelosidobeganlihimellabagamatutoringmalakiknighthahahacontinuessagingpagkaingdialledgabingtalemagpapabunotdapit-haponnanghihinamadcompostelasaboghapasinfeedback,charismatictulungankuninprogramsmanatilishiftpangangatawanablelumuwasmagbubungaglobalpasasalamatpandidiriplatformsneedsechavepersistent,hellotagaroonnagalitnakangitikampopanghimagasriskbalingngayontinapaykakaibangniyonmakamitmaglabapulangnakipaggjorthintuturotumagalbinitiwanjejunananaginiplumiitsalatinmagkababatainomsaansiyamklasehawakanmagbantaynatalopagsuboktuwidwhetherganitotugonnasisilawnapabalikwaskapangyahiranbabaeropinag-aralaninittinulak-tulakkumainakonagdadasalpocaengkantadangmakikiligowalletkongresomakaangaltabikwelyonagpupuntamagsayangkinasisindakannaglinisbandangpananakotbalitanakapikitmagtiwalatalentpakpakmagkakaanakleksiyoninastanagsinenaiinitanpakilagaykinatatalungkuangilalagaynatatawapriesthouseholdbusyangheykinagagalakmariamemorialsocialesiconsagwadoripinauutangwednesdaybati1920sumupocontent,peksmansonidocoalexpeditedshowsfonosdragonunconstitutionalpaglipasogorhabitiintayinhadnalangtsinanapatayowidestonehamkasintahanboksingyanpaki-ulitpusasusundoherepakealammagpa-ospitalbairdkristonagkasakitoutlinesaddictionpancitforcesnasanatinbigashagdanmagisingclearnakakapamasyalnapadaannahuliingatantatawag