Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "making"

1. A lot of money was donated to the charity, making a significant impact.

2. A lot of snow fell overnight, making the roads slippery.

3. All these years, I have been making mistakes and learning from them.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

6. Congress, is responsible for making laws

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Don't worry about making it perfect at this stage - just get your ideas down on paper

9. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

10. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

11. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

12. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

13. I am absolutely committed to making a positive change in my life.

14. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

15. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

16. It's time to pull yourself together and start making positive changes in your life.

17. Keep in mind that making money online takes time, effort, and patience

18. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

19. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

20. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

21. Madalas syang sumali sa poster making contest.

22. Making large purchases without consulting your budget is a risky move.

23. Omelettes are quick and easy to prepare, making them a convenient meal option.

24. Pull yourself together and stop making excuses for your behavior.

25. Research and analysis are important factors to consider when making investment decisions.

26. She has been making jewelry for years.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

29. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

30. The Flash can move at superhuman speed, making him the fastest man alive.

31. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

32. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

33. The website's content is engaging and informative, making it a great resource for users.

34. The website's design is sleek and modern, making it visually appealing to users.

35. The website's search function is very effective, making it easy to find the information you need.

36. There were a lot of options on the menu, making it hard to decide what to order.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Tila siya ang paboritong estudyante ng guro.

2. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

3. Ipabibilanggo kita kapag di mo inilabas ang dinukot mo sa akin.

4. We have been walking for hours.

5. Sweetness can be used to mask other flavors and create a more palatable taste.

6. Ok ka lang? tanong niya bigla.

7. Ano pa ho ang dapat kong gawin?

8. Proper maintenance, such as regularly oiling the pivot point and cleaning off debris, can prolong the lifespan of scissors.

9. Naglalaro kami ng 4 pics 1 word sa cellphone.

10. May grupo ng aktibista sa EDSA.

11. Yumabong ang pagpapahalaga sa kalusugan ng mga tao dahil sa mga kampanya para sa mga aktibidad sa fitness.

12. Some fruits, such as strawberries and pineapples, are naturally sweet.

13. Nakakatakot ang gagamba na kanyang nakita.

14. Magbantay tayo sa bawat sulok ng ating bayan.

15. Ayaw mo akong makasama ng matagal?

16. Nakakasama sila sa pagsasaya.

17. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

18. Tuwing may sakuna, nagkakaisa ang mga Pinoy sa pagtulong sa kapwa.

19. Siya ay hindi marunong magtimpi kaya't laging nagmamalabis sa pagpapahayag ng kanyang saloobin.

20. I complimented the pretty lady on her dress and she smiled at me.

21. Bakit wala ka bang bestfriend?

22. Kailangan mong malalim na pumasok sa kanyang kaibuturan upang maunawaan mo siya.

23. Mahigpit na binabantayan ng mga otoridad ang mga kilalang salarin sa lungsod.

24. Limitations can be physical, mental, emotional, financial, or social.

25. The United States is a federal republic, meaning that power is divided between the national government and the individual states

26. Twinkle, twinkle, all the night.

27. Nangangamba ako sa pagdidilim ng aking paningin dahil sa pagkakaroon ko ng mataas na grado.

28. Ang mga kabataan ay naglalaro ng computer games hanggang sa hatinggabi.

29. Jennifer Lawrence won an Academy Award for her role in "Silver Linings Playbook" and is known for her performances in the "Hunger Games" series.

30. No pierdas la paciencia.

31. I fell for an April Fool's joke on social media this year - a friend posted a fake news article that was so convincing I thought it was real.

32. Nag-iisa siya at tulala sa gitna ng kalsada nang makita ko siya kaninang umaga.

33. Pagkatapos nyang maligo ay lumuwas na ito ng maynila.

34. Ang takip-silim ay isa sa pinakamagandang panahon upang maglakad-lakad sa gabi.

35. He makes his own coffee in the morning.

36. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

37. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

38. Layuan mo ang aking anak!

39. Ang mga taong naghihinagpis ay nagtipon upang magbigay suporta sa isa't isa.

40. El arte puede ser utilizado para transmitir emociones y mensajes.

41. Sobra. nakangiting sabi niya.

42. Omelettes are a popular choice for those following a low-carb or high-protein diet.

43. Inalis ko yung pagkakayakap niya sa akin. At umupo sa sofa.

44. Mas maganda ang photoshoot sa dapit-hapon dahil ang ilaw ay nakakapagbigay ng ibang vibe.

45. Anong kulay ang gusto ni Elena?

46. Agradezco profundamente tu dedicación y esfuerzo.

47. All these years, I have been making mistakes and learning from them.

48. H-hindi na sabi eh! inis na sabi nya.

49. Bawal magpakalat ng mga labis na pamahiin dahil ito ay nagdudulot ng takot at kawalan ng kaalaman.

50. Sa takip-silim, nakakapagbigay ng romantikong vibe sa mga tao.

Similar Words

Lumaking

Recent Searches

largeamountmakinginistvsconsidermultotindahanwhileoftentablebehaviorcontentuniquecharitablemanagersquatterblessbroadcastsbitawanboxrightferrersyncnakasalubongexamplesedentarythirdworkshopresultrangehatefistsclassroomhumpaykasakitwhetherleestudiedpakainmagworksasagutinunti-untinakatindig1876quicklyhampaslupalumiwanagnamumulaklakjobumilingflightmagkaibangmasayahinsurenaglokopahiramtumamiscorporationmalulungkotnasuklamtenerpaaralankalarotatlotaxibanalattorneymaisiprelativelypagkaawaumigtadiwanandisposaldomingolipadyanlegislativefearplayedibigmamanhikanyou,kinatatakutanwakasfacilitatingpedeindividualcallingcigarettesflexiblebumibitiwnagtatakbolibreeducationalaayusinnasundocontrolledresourcespamamasyalthankablefallalabisthreeannamagisingpagkaangatsaranggoladatinakatunghayprivatebarcelonamanamis-namismahawaantemparaturasimbahanpagpapasannakauponagtungopresidentialsalamangkeropagtitiponsasayawintobaccolumikhaluluwaspinag-aralanaanhinkatuwaanhouseholdssukatpagkatakotpronounnahihilomahiwaganahintakutaniigibtatagalleksiyonphilanthropykulungannapatigilgayunmanmagbibigaysigesonglalakadnangangalitmakalaglag-pantygawinkamandagnakabibingingtagtuyottahanandissekinalalagyannanonooddotasiguradokusinainuulamrinpamagatkahongthemmasaganangtungonapakabilissaan-saanumuusighinihintaypalabasnatuwajackzsellkirbymaskinermagpakaramitumamacarbonnakasakaypigilaninfluentialtherapeuticsnanunurimahahabapapalapitlikodumuwinag-bookalintuntuninmakakakababayanasukalpusomaaksidentebloggers,saktankuliglig