Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "making"

1. A lot of money was donated to the charity, making a significant impact.

2. A lot of snow fell overnight, making the roads slippery.

3. All these years, I have been making mistakes and learning from them.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

6. Congress, is responsible for making laws

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Don't worry about making it perfect at this stage - just get your ideas down on paper

9. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

10. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

11. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

12. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

13. I am absolutely committed to making a positive change in my life.

14. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

15. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

16. It's time to pull yourself together and start making positive changes in your life.

17. Keep in mind that making money online takes time, effort, and patience

18. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

19. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

20. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

21. Madalas syang sumali sa poster making contest.

22. Making large purchases without consulting your budget is a risky move.

23. Omelettes are quick and easy to prepare, making them a convenient meal option.

24. Pull yourself together and stop making excuses for your behavior.

25. Research and analysis are important factors to consider when making investment decisions.

26. She has been making jewelry for years.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

29. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

30. The Flash can move at superhuman speed, making him the fastest man alive.

31. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

32. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

33. The website's content is engaging and informative, making it a great resource for users.

34. The website's design is sleek and modern, making it visually appealing to users.

35. The website's search function is very effective, making it easy to find the information you need.

36. There were a lot of options on the menu, making it hard to decide what to order.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Kumaripas ng takbo ang batang may dalang bola nang makita ang kanyang nanay.

2. Aling bisikleta ang gusto mo?

3. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

4. Anong pangalan ng lugar na ito?

5. Forgiveness is a powerful act of releasing anger and resentment towards someone who has wronged you.

6. Nagpaabot ako ng bulaklak sa kanyang bahay upang ipakita ang aking pagmamahal sa nililigawan ko.

7. Hay naku, kayo nga ang bahala.

8. The wedding cake was beautifully adorned with fresh flowers.

9. H-hindi na sabi eh! inis na sabi nya.

10. Yakapin mo ako, habang atin ang gabi.

11. Tiyak na may isda kang mahuhuli! Sige, layas! Layas! pinagtulakan ni Kablan ang kaawa-awang matanda na napasubsob sa tarangkahan ng malaking bahay.

12. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

13. Hindi naman halatang type mo yan noh?

14. Ano ang ginawa ni Tess noong Abril?

15. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

16. The dancers are not rehearsing for their performance tonight.

17. Many people work to earn money to support themselves and their families.

18. By refusing to compromise, she ended up burning bridges with her business partner.

19. She writes stories in her notebook.

20. Vivir con una conciencia limpia nos permite dormir mejor por la noche.

21. Ah miss, tanong lang... Iyo bang lahat yan?

22. Ang nagdudumaling laro ng chess ay nangangailangan ng matinding kasanayan sa pagtatanghal ng mga hakbang at galaw.

23. Tse! Anong pakialam nyo? Bakit maibibigay ba ninyo ang naibibigay sa akin ni Don Segundo? sagot ni Aya.

24. L'intelligence artificielle peut être utilisée pour détecter les fraudes financières et les menaces à la sécurité.

25. Pakitimpla mo ng kape ang bisita.

26. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

27. Limitations can be viewed as opportunities for growth and personal development.

28. Hayaan mo akong magbayad ng lahat.

29. Hindi nya masikmura ang harap-harapang panloloko ni mayor sa kanyang nasasakupan.

30. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

31. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

32. It can be helpful to create an outline or a mind map to organize your thoughts

33. I always feel grateful for another year of life on my birthday.

34. "A dog is the only thing on earth that loves you more than he loves himself."

35. Utiliza métodos orgánicos para combatirlas, como el uso de polvos de hierbas o infusiones

36. Después de terminar el trabajo, fuimos a celebrar con nuestros amigos.

37. Maitim ang dugo ang madalas sabihin kapag masama ang isang tao

38. Anong buwan ang Chinese New Year?

39. Ang sugal ay isang problema ng lipunan na dapat labanan at maipagbawal para sa kapakanan ng mga tao.

40. It was supposed to be a surprise promotion, but the boss let the cat out of the bag during a meeting.

41. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

42. Ang pagiging makapamilya ay isa sa pinakamagandang katangian ng mga Pinoy.

43. The popularity of coffee has led to the development of several coffee-related industries, such as coffee roasting and coffee equipment manufacturing.

44. The store was closed, and therefore we had to come back later.

45. Nakita kita sa isang magasin.

46. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

47. Sa tuwing nakikita ko ang aking kabiyak, nadarama ko ang kumpletong kaligayahan sa aking puso.

48. The "News Feed" on Facebook displays a personalized stream of updates from friends, pages, and groups that a user follows.

49. Si Ranay ay isang matakaw na batang nakatira sa mahirap na bayan ng Sto. Domingo.

50. Mahirap kalabanin ang sakit na nagdadala ng agaw-buhay na pakikibaka.

Similar Words

Lumaking

Recent Searches

makingpinalakingdividesnotworldpresleyisusuotpunsoincludingsecarsepresidentfindmatumalbanyoadvertisingcountriesakmangtumatawagmalayangchavitpeppyleadnagagandahantenidoiyopublicitydiretsahangpinakamatapatnakapangasawamarilourepublicanstreetoktubrenagmumukhahilingchickenpoxbutchresearch,patutunguhanmatigashiwasumasakitarteagam-agamgagpinaghatidanjenananigashalu-halohandaansalaminpsssfuelnasasabihankasakitbutterflybinulongkantokomunikasyonsumimangotanubayancriticssinipangcrecerpagtiisanpagkabuhaysupilinateeeeehhhhnapansinmaatimtakesmoodcuandoeksaytedtandaqualitykamatismatindingnabigkasnakisakaynakakagalakasingmestupworkwouldworrymbricosmakilingimprovedpasinghaltipidorderinsafestyrercomputerlinggongpinilitpinakamatabangbangkangmedicinemagkikitaeyegeneinterests,eksport,iyakkatagaheylasaapologeticyesmaipapautangkastilangmiratanganparusahanmonumentonodkapataganbarongdyipkasonasuklamnakasuotmagsugalresumensinunodkumukuhainisdamdaminsentencepantalongagilitynatingalalackyumabongkumapitmagpuntainternajocelynoverincluirdawdiaperplagasi-rechargetsonggonakabalikrestsourcestilganglabahinnagwalismagpapalitinintaycomienzanbroughtkargahandisyembrepaki-drawingprincipalesnagpanggaphanapbuhayganangkuyaisinuotcancerdyosamatagpuanhinilaadgangpakakatandaanshadesgasolinailigtasbusogcampaignsmarketingmasasayakatagalangranadafranciscopopularkahongpagkaawalabismedikalhuwebesingatandi-kawasatrentalagistopsaktanunattendeddraybermangingibigbetatagalog