Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "making"

1. A lot of money was donated to the charity, making a significant impact.

2. A lot of snow fell overnight, making the roads slippery.

3. All these years, I have been making mistakes and learning from them.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

6. Congress, is responsible for making laws

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Don't worry about making it perfect at this stage - just get your ideas down on paper

9. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

10. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

11. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

12. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

13. I am absolutely committed to making a positive change in my life.

14. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

15. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

16. It's time to pull yourself together and start making positive changes in your life.

17. Keep in mind that making money online takes time, effort, and patience

18. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

19. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

20. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

21. Madalas syang sumali sa poster making contest.

22. Making large purchases without consulting your budget is a risky move.

23. Omelettes are quick and easy to prepare, making them a convenient meal option.

24. Pull yourself together and stop making excuses for your behavior.

25. Research and analysis are important factors to consider when making investment decisions.

26. She has been making jewelry for years.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

29. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

30. The Flash can move at superhuman speed, making him the fastest man alive.

31. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

32. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

33. The website's content is engaging and informative, making it a great resource for users.

34. The website's design is sleek and modern, making it visually appealing to users.

35. The website's search function is very effective, making it easy to find the information you need.

36. There were a lot of options on the menu, making it hard to decide what to order.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

2. Nasa kuwarto po siya. Sino po sila?

3. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

4. Aalis siya sa makalawa ng umaga.

5. Maria Rosario Toribio ang buong pangalan ko.

6. I finally finished my degree at age 40 - better late than never!

7. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

8. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

9. Ikaw na nga lang, hindi pa ako nagugutom eh.

10. Over-emphasis can be counterproductive and may undermine the intended message.

11. Kepulauan Raja Ampat di Papua adalah salah satu tempat snorkeling dan diving terbaik di dunia.

12. Ang utang ay maaaring magdulot ng stress at anxiety kung hindi ito maayos na hinaharap.

13. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

14. Nakatanggap ako ng email sa dakong huli ng gabi mula sa aking boss.

15. Sa gabi, natatanaw ko ang mga bituin na kumikislap sa langit.

16. Receiving recognition for hard work can create a sense of euphoria and pride.

17. Sa kanyang bakasyon, nagpasya siyang lumibot sa iba't ibang tourist spots ng bansa.

18. Ngumiti siya at lumapit kay Maico.

19. Sa huling pagkakataon ang mga isda ay nagsalita.

20. Isang matandang lalaki naman ang tumikim sa bunga.

21. Kucing dapat dilatih untuk melakukan beberapa trik seperti menjulurkan tangan untuk berjabat tangan atau melompat melalui ring.

22. Sumaya ang mundo ni kuya dahil sa iyo.

23. Nagdala si Butch ng laruan para sa bata.

24. Dalam Islam, kelahiran bayi yang baru lahir diiringi dengan adzan dan takbir sebagai bentuk syukur kepada Allah SWT.

25. Para sa malilimutin, malaking tulong ang paggamit ng alarm sa cellphone.

26. Emphasis can be used to create a sense of drama or suspense.

27. Es importante ser conscientes de nuestras acciones y cómo pueden afectar a los demás.

28. Wala nang gatas si Boy.

29. Las hojas de otoño son muy bonitas en la ciudad.

30. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

31. Les personnes âgées peuvent avoir des problèmes de sommeil en raison de la douleur et de l'inconfort.

32. Minsan, masarap din namang kumain ng nag-iisa para mapag-isipan ang mga bagay-bagay.

33. Ang arte. bulong ko sa may batok niya.

34. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

35. El invierno es una de las cuatro estaciones del año.

36. Madalas mapagalitan si Jake dahil sa pagiging malilimutin niya sa trabaho.

37. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

38. Nagsisunod ang mga kawal sa palasyo pati ng mga nasasakupan.

39. The United States is the world's largest economy and a global economic superpower.

40. Gaano siya kadalas uminom ng gamot?

41. Ganid ang tawag sa mga taong walang inatupag kundi ang makapanglamang sa kapwa.

42. Limitations can be overcome through perseverance, determination, and resourcefulness.

43. He has been working on the computer for hours.

44. Ang pagpapatingin sa dentista ay hindi lamang para sa kalusugan ng ngipin, kundi para na rin sa kabuuan ng kalusugan ng katawan.

45. Writing a book is a long process and requires a lot of dedication and hard work

46. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

47. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

48. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

49. The car broke down, and therefore we had to call for roadside assistance.

50. Heto po ang isang daang piso.

Similar Words

Lumaking

Recent Searches

nutsmakingcornergenerationsbathalajohnservicesimulatlumalakadsawakamingunitkatutubobowlamendmentskaymakawalanoblenakakatakothadlangmasasakitbefolkningen,negosyopinunitmakapagempakenagmungkahiinspirasyonnagtungodoble-karaphilanthropynakatitigusanasaangseryosongmaramimournedilagayendvideresurroundingsmasipaglabinsiyammaayosaksidenteyeynoonagplaydikyamalamidproblemalapatpookdyanrestawantanghalimanuelparatinguponmedidacallingdumaramidoingipatuloywariagadvehiclesamerikadalawabiluganginaanaycelularespisoadangmakapangyarihangnabalitaanmakapaibabawnagtatakbomurang-muranagawangnag-iisamaglalaronananalomerlindapagngitipagsumamokasangkapannagmamadalipagpapasandaramdaminnalugmoknasiyahantiktok,mabihisaninsektongkaharianhitagandahannaghuhumindighumiwalaymaya-mayaabundantepaghangamanahimikencuestasumakbayhanapbuhayfitnesstemparaturalalakipaghaharutankabutihanumiibignapahintomasasabigumuhitre-reviewnanalopatakbomaasahanpananglawnanunuripagkagisingnanunuksoatentosementeryonatitiyakculturesmahaboltaospahabolcardiganginawarantutusinisinusuotpasaheronagreplypromisebumalikikatlongininompagpalitbarcelonacramepigilanoperativosvictoriajeepneykamalianandoyreynamaalwangengkantadamagdilimlupainagilasiranaiwangngipinggatoljolibeekapaligiransubalitproudtuvoyunoutlinetasakasalnatagalantinitindainiintayorganizetiningnanangelamatagpuanbalangsumamaisugabatodisappointlimossumasambapigingbinigyangawashopeesaidpitodinalawnaglokotrenhdtvsumagotipantalopassociationhumbleyarigodtfriendsopo