Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "making"

1. A lot of money was donated to the charity, making a significant impact.

2. A lot of snow fell overnight, making the roads slippery.

3. All these years, I have been making mistakes and learning from them.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

6. Congress, is responsible for making laws

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Don't worry about making it perfect at this stage - just get your ideas down on paper

9. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

10. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

11. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

12. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

13. I am absolutely committed to making a positive change in my life.

14. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

15. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

16. It's time to pull yourself together and start making positive changes in your life.

17. Keep in mind that making money online takes time, effort, and patience

18. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

19. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

20. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

21. Madalas syang sumali sa poster making contest.

22. Making large purchases without consulting your budget is a risky move.

23. Omelettes are quick and easy to prepare, making them a convenient meal option.

24. Pull yourself together and stop making excuses for your behavior.

25. Research and analysis are important factors to consider when making investment decisions.

26. She has been making jewelry for years.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

29. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

30. The Flash can move at superhuman speed, making him the fastest man alive.

31. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

32. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

33. The website's content is engaging and informative, making it a great resource for users.

34. The website's design is sleek and modern, making it visually appealing to users.

35. The website's search function is very effective, making it easy to find the information you need.

36. There were a lot of options on the menu, making it hard to decide what to order.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Namnamin mo ang bawat subo ng masarap na ulam.

2. Mula sa kinatatalungkuang giray na batalan, saglit siyang napatigil sa paghuhugas ng mumo sa kamay.

3. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

4. Ang hudyat ay isang senyales o tanda na nagbibigay impormasyon o nagpapahayag ng isang ideya o kaisipan.

5. Ang pagtuturo ng mga guro ay nagpapalaganap ng kaalaman at abilidad sa mga mag-aaral.

6. Simula nung gabing iyon ay bumalik na ang sigla ni Nicolas at nagsimula na siyang manilbihan sa Panginoon

7. Grabe naman ang lockdown na yan ilang buwan na.

8. "Let sleeping dogs lie."

9. Sa araw araw na pagkikita ng dalawa ay nahulog na ang loob nila sa isa't-isa

10. Algunos powerbanks tienen múltiples puertos USB para cargar varios dispositivos al mismo tiempo.

11. High-definition television (HDTV) has become increasingly popular, and this has led to a significant improvement in picture quality

12. Si Rizal ay kilala bilang isang makata, manunulat, pintor, doktor, at lider sa paglaban sa kolonyalismong Espanyol.

13. Cancer can impact different organs and systems in the body, and some cancers can spread to other parts of the body.

14. Bumili ako ng prutas sa Berkeley Bowl.

15. Para sa anak ni Consuelo ang T-shirt.

16. Para aliviar un resfriado, puedes hacer una infusión de hierbas como el eucalipto y la manzanilla.

17. When I saw that Jake and his friends all had tattoos and piercings, I thought they might be a rough crowd - birds of the same feather flock together, right?

18. Oh, eh bakit naman? tanong naman nung isa.

19. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

20. Pagkuwa'y bigla na lamang nitong kakayurin ng hintuturo ang balat sa kanyang batok.

21. Magsasalita na sana ako ng sumingit si Maico.

22. She donated a significant amount to a charitable organization for cancer research.

23. Pero bigla na lang siyang hindi nagpakita.

24. Unti-unti siyang palayo sa pangkat dahil nais niyang mapag-isa.

25. Nagbigay siya ng magalang na pasasalamat sa tulong na ibinigay ng kanyang kaibigan.

26. A wedding is a ceremony in which two people are united in marriage.

27. Sin agua, los seres vivos no podrían sobrevivir.

28. Ikinalulungkot ko ang balitang yan.

29. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

30.

31. Hanggang kailan mo ako girlfriend? diretsahang sabi ko.

32. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

33. Electric cars can provide a more connected driving experience through the integration of advanced technology such as navigation systems and smartphone apps.

34. Kailangan nating magsimula sa pagkakaroon ng pangarap upang magkaroon ng inspirasyon sa buhay.

35. Biglang kumaripas ng takbo ang magnanakaw nang makita ang mga pulis.

36. Bilang paglilinaw, ang sinabi kong oras ng meeting ay alas-dos ng hapon, hindi alas-tres.

37. Technology has also played a vital role in the field of education

38. Ininom ni Henry ang kape sa kusina.

39. Naku, ang taas pala ng temparatura ko.

40. Two heads are better than one.

41. He has been hiking in the mountains for two days.

42. Begyndere bør starte langsomt og gradvist øge intensiteten og varigheden af ​​deres træning.

43. Catch some z's

44. Lebih baik mencegah daripada mengobati.

45. Ang blogger ay nagsusulat ng mga blog post upang ibahagi ang kaniyang mga opinyon at karanasan.

46. Psss. napatignin ako kay Maico. Naka-smirk siya.

47. Sino ba talaga ang tatay mo?

48. El internet ha cambiado la forma en que las empresas interactúan con sus clientes.

49. La historia del arte abarca miles de años y se extiende por todo el mundo.

50. She spilled the beans about the surprise party and ruined the whole thing.

Similar Words

Lumaking

Recent Searches

makinglargematalinocontrolanutsallowedmalapitpakilutotrentapanginoonhabitfuncionarnakatindigmag-aaralbehindevolvedpagpapakalatkusineroproductividadnangangakoblusaumanokasitumahannagsmilenaglalabasakaphilosophicalbadingtumutubocommunicationminutenatutuwaobservation,skillsbagkus,infusionesnapagodgrammardonnatatanawtuwangpageantdaysmabutingmainstreamteachlaylaynamungatonnapaiyakrebolusyontusindvisnakabibingingsasakyanlumilingonpookmaibibigayislaincidencepayongpagbahingsahigangalstreaminggayunmanestasyonbirdsipinambilimanybinilimandirigmanghurtigeresayomainittinulak-tulaktabing-dagatenforcingnakapagsabikuwentofitnasisilawsalatnag-replykasalukuyannatalongpaglingabaduynagdaramdamwebsitebilhinaniformnapaghatianhumalolalabhanmasamakapagpaglayaslumiwanagbakakatutubomanuksonanlakinagbabasakatipunankabibimawawalamagkapatidpakikipagbabagpositibohamakmanonoodrosasdadalawinkaklasenapagtantotekamatangumpaysikmuralumangikawalongvariousarbejderbaguioclassroomandroidrebounddumarayodragonpantalonpabalangcountlesspakisabimagtipidautomatiskbuwalnaturalyumaobagyofeelsasabihinlangkapilingmag-galaalituntuninpinalakingstockskami1940isinamamahabatengademocraticagilapunoiikotmagdamaganvedsalu-salouulaminnapansinpinalalayaspinangstatusdistancesnakilalalokohinbasahantupeloahitkumampinagibangtumahimikmaabutannaaalalagisingnapakabutinapaluhanagtatakabumitawscottishryannaglakadpaghaharutaneconomykabiyakgumapangproudpisarakatulongpabulongaksiyoniniinomchesskararatingmaalalatumulaknakapagusappagkikita