Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

37 sentences found for "making"

1. A lot of money was donated to the charity, making a significant impact.

2. A lot of snow fell overnight, making the roads slippery.

3. All these years, I have been making mistakes and learning from them.

4. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

5. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

6. Congress, is responsible for making laws

7. Different investment vehicles may be subject to different fees and expenses, and investors should consider these costs when making investment decisions.

8. Don't worry about making it perfect at this stage - just get your ideas down on paper

9. Facebook has billions of active users worldwide, making it one of the largest social media platforms.

10. Financial literacy, or the understanding of basic financial concepts and practices, is important for making informed decisions related to money.

11. Foreclosed properties are often sold at a discounted price, making them an attractive option for real estate investors.

12. Frustration can lead to impulsive or rash decision-making, which can make the situation worse.

13. I am absolutely committed to making a positive change in my life.

14. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

15. It can create a sense of urgency to conceive and can lead to conversations and decision-making around fertility, adoption, or other means of becoming parents.

16. It's time to pull yourself together and start making positive changes in your life.

17. Keep in mind that making money online takes time, effort, and patience

18. La esperanza nos permite ver un futuro mejor y trabajar para hacerlo realidad. (Hope allows us to envision a better future and work towards making it a reality.)

19. LeBron James continues to inspire and influence future generations of athletes with his remarkable skills, leadership, and commitment to making a difference both on and off the court.

20. Los sueños pueden ser grandes o pequeños, lo importante es tenerlos y trabajar para hacerlos realidad. (Dreams can be big or small, what's important is to have them and work towards making them a reality.)

21. Madalas syang sumali sa poster making contest.

22. Making large purchases without consulting your budget is a risky move.

23. Omelettes are quick and easy to prepare, making them a convenient meal option.

24. Pull yourself together and stop making excuses for your behavior.

25. Research and analysis are important factors to consider when making investment decisions.

26. She has been making jewelry for years.

27. The company might be offering free services, but there's no such thing as a free lunch - they're probably making money another way.

28. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

29. The dedication of volunteers plays a crucial role in supporting charitable causes and making a positive impact in communities.

30. The Flash can move at superhuman speed, making him the fastest man alive.

31. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

32. The new smartphone model is incredibly lightweight, making it easy to carry around all day.

33. The website's content is engaging and informative, making it a great resource for users.

34. The website's design is sleek and modern, making it visually appealing to users.

35. The website's search function is very effective, making it easy to find the information you need.

36. There were a lot of options on the menu, making it hard to decide what to order.

37. Twitter has millions of active users worldwide, making it a powerful tool for real-time news, information, and social networking.

Random Sentences

1. Nagliliyab ang puso ni Andres sa pagmamahal para sa kanyang pamilya.

2. Holding onto grudges and refusing to forgive can weigh us down emotionally and prevent personal growth.

3. Ang mga mata niyang banlag ay animo'y laging gulat.

4. Emphasis can be used to create rhythm and cadence in language.

5. Pakain na ako nang may dumating na bisita.

6. Las redes sociales también son un medio para hacer negocios y promocionar productos.

7. The United States is home to some of the world's leading educational institutions, including Ivy League universities.

8. Beauty. si Maico sabay yakap sa akin mula sa likod.

9. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

10. Sa tuwing nakikita kita, nadarama ko na may gusto ako sa iyo.

11. Napatigil siya bigla at nabitawan yung kamay ko.

12. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

13. Sa isang linggo ay pupunta kami sa Singapore.

14. Instagram has a "feed" where users can see posts from the accounts they follow, displaying images and videos in a scrolling format.

15. Hindi naman. Baka lang pagod ka na...

16. Agosto pa lamang ay may mga pang paskong dekorasyon na sa mga malls.

17. Walang bagay na di makita at agad tinatanong ang kanyang ina.

18. Membantu orang lain dan berkontribusi pada masyarakat juga memberikan perasaan kebahagiaan yang mendalam.

19. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

20. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

21. Ako ay nagtatanim ng mga halaman sa aking bakuran.

22. Ang bayan na matatagpuan sa lugar ng mga bundok, ay hindi matatag sa pagkakataong darating ang unos.

23. Madalas na naglulusak sa dumi ang mga bakuran.

24. En invierno, se puede disfrutar de hermosos paisajes cubiertos de nieve.

25. Higupin natin ang gatas habang mainit pa.

26. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

27. Ang mga anak-pawis ay kadalasang nakakaranas ng diskriminasyon sa lipunan.

28. May dalawang puno sa harap ng bahay namin.

29. La música que produjo el compositor fue muy innovadora para su época.

30. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga mapanganib na mikrobyo sa mga kalsada at iba pang mga lugar.

31. Ang mga botanista ay nagtatanim ng mga endemikong halaman sa mga pook kagubatan.

32. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

33. Wala kang sapat na pera para sa bakasyon? Kung gayon, ipagpaliban mo muna ito.

34. Sa kultura ng mga Igorot, mahalaga ang punong-kahoy dahil ito ang ginagamit sa kanilang mga ritwal.

35. Ang aming angkan ay nagpapahalaga sa tradisyong pamilya.

36. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

37. Nakikinig ako sa mga kanta ng Bukas Palad tuwing Linggo sa simbahan.

38. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

39. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

40. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

41. May bagong batas na ipinatupad ukol sa proteksyon ng mga manggagawa.

42. Eine Inflation kann auch durch den Anstieg der Rohstoffpreise verursacht werden.

43. Sa ilalim ng malawak na upuan, nakita ko ang isang mayabong na lumot.

44. Naging masyadong mayabang ang bata at nararapat daw itong parusahan.

45. Sasabihin ko na talaga sa kanya.

46. Ang tagumpay ng aking mga estudyante ay siyang ikinagagalak ng aking puso.

47. Iwinasiwas nito ang nagniningning na pananglaw.

48. Tantangan hidup dapat memperkuat hubungan dengan orang-orang terdekat, karena mereka dapat memberikan dukungan dan perspektif yang berharga.

49. Hindi kita puwedeng iwan dahil mahal kita.

50. Gusto ng mga batang maglaro sa parke.

Similar Words

Lumaking

Recent Searches

nutsmakinginfluenceprotestainternalthingandyfacehealthiernapakagandangjohngayunpamantatawagannanlakisabogmagitingmagulayawsikipmangingisdainfluencesfilipinopinangyarihanlalabhantokyoisinagotibinentamayamanpabalangbaoinulitagaddagat-dagatandurimeetbehindsumapitmanoodsiembrataun-taonanotherfallkinalakihanincluirumakbayprodujomangahasnagagamitnakapasamakikitulogmarurumiencuestasnakasakitninanaismatagpuanfitnessmagpalagonabighanipinuntahannakakarinignapagtantomaipagmamalakingmananakawtitapaki-drawinghahatolmakakakaenpinag-aralanpakikipagtagponakakitanagkitasundhedspleje,kagalakannagpaiyakalikabukinnagtuturomagpaliwanagnananaghilinagsusulatnagtitindagayunmanreserbasyonnanghihinamagkaibanginsektongpinaghatidanuugud-ugodcrucialmatapobrengbumisitabinibiyayaandadalawinnagmamadalinakalilipasnagpalalimhinahanapmasaktanmagsungitnatabunanbumaligtadpinalalayasstorykakutispagbigyannaglokohantinungoautomatiskmabatongnakalockhurtigereedukasyonmagdaraostumalontatanggapintumikimkaramihanpinigilanmagpasalamatthanksgivingnapatigilpanindamusicaleskabighapwedengminerviemahabolbahagyagovernorsmatumalmahahawacramejosiemalalakinakangisinghinanakithonestokanayangctricasbiglaannabiglautilizannakapikitincitamenterikatlongdescargarroofstockaayusinrimasiikotnatakotgagamitinpangakoinstitucionesagilacurtainsahhhhimportanteipinambilianteshinahaplosgustongbibigyansahodbumagsakpinakamalapitminamasdanipagmalaakiquarantinemisteryotawadisenyoipinanganaktsinelaspokergownnaiwangtibokganunpamankasalkasalanangymsadyangmatayogmaisippromotesalbahesuwailnanaynakatinginbisikletapulitikoplasalegacyutilizarkarapatanpigingiyankelantinikisama