Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

28 sentences found for "intelligence"

1. Additionally, the use of automation and artificial intelligence has raised concerns about job displacement and the potential for these technologies to be misused

2. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

3. Einstein's brain was preserved after his death and has been studied by scientists to try to understand the neural basis of his exceptional intelligence.

4. He admired her for her intelligence and quick wit.

5. It may dull our imagination and intelligence.

6. L'intelligence artificielle est un domaine de l'informatique qui vise à développer des systèmes intelligents.

7. L'intelligence artificielle peut aider à améliorer les traitements médicaux et les diagnostics.

8. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

9. L'intelligence artificielle peut aider à optimiser les processus de production industrielle.

10. L'intelligence artificielle peut aider à prédire les comportements des consommateurs et à améliorer les stratégies de marketing.

11. L'intelligence artificielle peut être utilisée pour aider à la planification urbaine et à la gestion des transports.

12. L'intelligence artificielle peut être utilisée pour détecter et prévenir les activités criminelles.

13. L'intelligence artificielle peut être utilisée pour détecter les fraudes financières et les menaces à la sécurité.

14. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

15. L'intelligence artificielle peut être utilisée pour prédire les résultats des élections et des événements futurs.

16. Les algorithmes d'intelligence artificielle peuvent apprendre à partir de données et améliorer leur performance au fil du temps.

17. Les algorithmes d'intelligence artificielle peuvent être utilisés pour optimiser la consommation d'énergie dans les bâtiments.

18. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

19. Les assistants personnels virtuels, tels que Siri et Alexa, utilisent l'intelligence artificielle pour fournir des réponses aux questions des utilisateurs.

20. Les chatbots d'intelligence artificielle peuvent aider les entreprises à répondre aux demandes des clients.

21. Les outils de reconnaissance faciale utilisent l'intelligence artificielle pour identifier les individus dans les images.

22. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

23. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

24. Les systèmes de recommandation d'intelligence artificielle peuvent aider à recommander des produits et des services aux clients.

25. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

26. Musk has been vocal about his concerns over the potential dangers of artificial intelligence.

27. The TikTok algorithm uses artificial intelligence to suggest videos to users based on their interests and behavior.

28. When we read books, we have to use our intelligence and imagination.

Random Sentences

1. Ang kamalayan sa kalagayan ng kalikasan ay nagtutulak sa atin na alagaan ito para sa susunod na henerasyon.

2. Kagyat na bumaha ang nakaliliyong dilim sa kanyang utak.

3. Setiap orang memiliki definisi kebahagiaan yang berbeda-beda.

4. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

5. Amazon's Kindle e-reader is a popular device for reading e-books.

6. Maiiwasan ang bungang-araw kung paliligo nang regular.

7. Hindi ko maintindihan kung bakit may mga taong ganito mag-isip.

8. Las plantas ornamentales se cultivan por su belleza y se utilizan para decorar jardines y espacios interiores.

9. Gracias por tu amabilidad y generosidad.

10. Tanging si Tarcila lang ang walang imik ngunit malalim ang iniisip.

11. Me siento caliente. (I feel hot.)

12. Gusto ko na umuwi ng Pilipinas.

13. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

14. Las escuelas tienen una política de tolerancia cero para el acoso escolar.

15. Investment returns are subject to taxes, and investors should consider the tax implications of their investments.

16. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

17. Magpapabakuna ako bukas.

18. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

19. The culprit behind the product recall was found to be a manufacturing defect.

20. Si Carlos Yulo ay kilala bilang isa sa pinakamahuhusay na gymnast sa buong mundo.

21. Tinapos ko ang isang season sa netflix kaya napuyat ako.

22. Ang pagpapakain ng mga biko at tikoy ay isa sa mga tradisyonal na gawain tuwing Chinese New Year.

23. Sa aming bakuran, nagtatanim kami ng mga tanim na pampalasa tulad ng luya at sibuyas.

24. Mga mangga ang binibili ni Juan.

25. Isa ang edukasyon sa pinakamahalagang bagay na hindi mananakaw ninuman.

26. Los powerbanks con tecnología de carga rápida pueden cargar los dispositivos más rápido que los cargadores convencionales.

27. She always submits her assignments early because she knows the early bird gets the worm.

28. Maraming tao. Isa pa, baka makita tayo ng girlfriend mo.

29. Sa kabila ng kanyang tagumpay, may bahid ng lungkot sa kanyang mga mata.

30. Imulat ang isipan sa mga kulay ng buhay.

31. La paciencia es una cualidad que se debe cultivar.

32. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

33. Las labradoras son conocidas por su energía y su amor por el agua.

34. El arte puede ser utilizado para fines políticos o sociales.

35. Additionally, the use of mobile phones has raised concerns about privacy, as the devices can be used to track individuals' locations and gather personal information

36. The scientific method is used to test and refine theories through experimentation.

37. Cryptocurrency is still a relatively new and evolving technology with many unknowns and risks.

38. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

39. Hindi dapat natin balewalain ang pag-unlad ng ating komunidad, samakatuwid.

40. Magandang umaga po, mga mahal na manonood.

41. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

42. Kuripot daw ang mga intsik.

43. Naguusap na tayo. Narining ko siyang nag sigh

44. Mag o-online ako mamayang gabi.

45. Ang poot ay sumisindi sa aking puso sa tuwing naalala ko ang mga pagkakataon na ako'y iniwan at sinaktan.

46. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

47. Regular exercise and playtime are important for a dog's physical and mental well-being.

48. Rutherford B. Hayes, the nineteenth president of the United States, served from 1877 to 1881 and oversaw the end of Reconstruction.

49. Hindi niya alam kung paano niya haharapin ang buhay na nag-iisa.

50. Ang puting pusa ang nasa sala.

Recent Searches

intelligencethirdsyncmultokasingwaitflashbitbitpatrickjunjunrangeviewreturnedmakapangyarihannakakatawamalasutlamustparkepumasokeksempelbituinalampaglapastangannagmamaktolatensyongkusineroskillsinfusionessabongimpactoteachnoonlondonbutikielectwhyellenbadkaninangfigureipagtimplanakakatabastudiedshiftmagtataaspasalamatannaliligosahodpagdiriwanginvolvejaceseguridadrevisenanghihinadumilatdisselibertyguardaricaanak-pawispumuntasagotsabieeeehhhhsongmentalpatientmaglaba1920skanoupuanperabalancesforcesbubongofferdevelopmentpapuntanagtitiispakikipagtagpopagkalungkotnagpapaniwalanagsusulatpinakamaartengpinagmamalakiknightmaaaringanyothanksgivinginuulamnakatitigmanahimiktumawakinalalagyankontratakondisyonpinigilanyumaosabihinmagsugalmagpahabanakakainnasasalinannakahugnaglulutolinggongmagdamaganmagkasabaytv-showspagkaraahitikcinejosekapeaudiencecomputere,dyipdinanaspadabogbumabagfriendshuwebeskongmanuksozoobangkodibadikyamelectoralsumigawchoosepaksapigingpuwedeaminbakitiniibigmatulissundaefitmulighedersiglolistahankalongabangandasaliigibindividualspublishing,lazadamatitigasforståsandalisisterarkilamatamanharmfulkararatingsumangmatabasatisfactiongamesballbilertvsstonehamcharmingpedeminutebrancheschessfataudio-visuallyproducirlulusogreservedshownathantinalikdanvehiclesbilldatisinongdedication,tanimtools,sparksumugodpoweraftermagpuntamisarhythmasimuporedigeringpakaincentereuphoricreaders