Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

30 sentences found for "natural"

1. Ang tubig-ulan ay nagbibigay ng natural na tubig sa mga lawa at ilog, na nagbibigay ng tahanan at pagkain sa mga isda.

2. Chatbots and virtual assistants are examples of AI applications that use natural language processing to interact with users.

3. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

4. Conservation efforts, such as protecting natural habitats and endangered species, are critical to maintaining a healthy environment.

5. El ciclo del agua es un proceso natural que involucra evaporación, condensación y precipitación.

6. El parto es un proceso natural y hermoso.

7. El parto natural implica dar a luz a través del canal vaginal, mientras que la cesárea es una operación quirúrgica que implica hacer una incisión en el abdomen de la madre.

8. El parto puede ser natural o por cesárea, dependiendo de las circunstancias y la salud de la madre y el bebé.

9. Environmental protection requires educating people about the importance of preserving natural resources and reducing waste.

10. God is often seen as the creator of the universe, with the power to influence and control natural phenomena and human destiny.

11. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

12. Las hierbas silvestres crecen de forma natural en el campo y se pueden utilizar en infusiones.

13. Las plantas nativas son especies que se encuentran de forma natural en un determinado lugar y son importantes para la conservación de la biodiversidad.

14. Lazada has partnered with government agencies and NGOs to provide aid and support during natural disasters and emergencies.

15. Mabilis siyang natutunan ang mga bagong teknolohiya dahil sa kanyang natural na abilidad sa kompyuter.

16. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

17. Nakakatulong ang malawak na bintana sa silid-aralan upang pumasok ang natural na liwanag sa loob ng silid.

18. Natural language processing is a field of AI that focuses on enabling machines to understand and interpret human language.

19. Our transport systems-diesel-run railways, steamships, motor vehicles, and aeroplanes-all constantly need natural fuel to keep on moving

20. Protecting the environment involves preserving natural resources and reducing waste.

21. Saya sayang dengan keindahan alam di Indonesia. (I love the natural beauty of Indonesia.)

22. Scientific inquiry is essential to our understanding of the natural world and the laws that govern it.

23. Sweetness can also be found in natural sweeteners, such as honey and maple syrup.

24. Sweetness is a sensation associated with the taste of sugar and other natural and artificial sweeteners.

25. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

26. The Galapagos Islands are a natural wonder, known for their unique and diverse wildlife.

27. The La Brea Tar Pits are a unique natural attraction, preserving fossils and prehistoric remains.

28. The Northern Lights, also known as Aurora Borealis, are a natural wonder of the world.

29. The Serengeti National Park in Tanzania is a natural wonder renowned for its wildlife and annual migration.

30. While baby fever can be a powerful and overwhelming experience, it is a natural part of the human desire to create and nurture life.

Random Sentences

1. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

2. Sweeteners are often used in processed foods to enhance flavor and extend shelf life.

3. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

4. Before television, most advertising was done through print media, such as newspapers and magazines

5. Simula noon ay hindi na nga nakikihalubilo si Paniki sa kahit anong hayop.

6. Teka, pakainin na muna natin sila. ani Jace.

7. If you don't want me to spill the beans, you'd better tell me the truth.

8. La lluvia produjo un aumento en el caudal del río que inundó la ciudad.

9. Gaano ka kadalas uminom ng bitamina?

10. Smoking cessation can have positive impacts on the environment, as cigarette butts and packaging contribute to litter and environmental pollution.

11. She decorated the cake with colorful sprinkles and frosting.

12. Nagsisilbi siya bilang librarian upang magbigay ng access sa kaalaman sa mga nagbabasa ng kanyang aklatan.

13. Time management skills are important for balancing work responsibilities and personal life.

14. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

15. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

16. Ibinigay ko na ang lahat ng makakaya ko upang matulungan ka.

17. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

18. Hockey is played with two teams of six players each, with one player designated as the goaltender.

19. ¿Dónde vives?

20. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

21. Yumabong ang pagkakaisa ng mga tao sa panahon ng krisis.

22. The team won a series of games, securing their spot in the playoffs.

23. Elektronikken i en bil kan hjælpe med at forbedre kørsel og sikkerhed.

24. Laking galak nito nang matagpuan ang maraming itlog ng bayawak, at tuwang-tuwa na tinirador ang mga itlog.

25. Masaya ang pakanta-kantang si Maria.

26. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

27. Sa mga taludtod ng kundiman, nararamdaman ang saya at lungkot na dulot ng pag-ibig.

28. Mag-aaral ako sa unibersidad sa susunod na taon.

29. Siya ay hinugot mula sa kanyang pagkakakulong matapos ma-prove na walang kasalanan.

30. At isang araw nga, nagpasya sina Damaso at Magda na tumakas at mamuhay sa ibang lugar.

31. Hinde ko alam kung bakit.

32. Naroon sa tindahan si Ogor.

33. Ang awitin ng makata ay puno ng hinagpis na naglalarawan ng kanyang pagkabigo sa pag-ibig.

34. Il est important de prendre en compte les risques potentiels et de faire des recherches approfondies avant de décider de participer à des activités de jeu.

35. La alimentación saludable debe incluir una variedad de proteínas, carbohidratos y grasas saludables.

36. Siyang pagdating ni Roque na agad ding tumalon sa ilog upang iligtas ang mga anak.

37. Ano ang gusto mo, sinigang o adobo?

38. La internet ha cambiado la forma en que las personas acceden y consumen información en todo el mundo.

39. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

40. Hindi kita puwedeng iwan dahil mahal kita.

41. Laughter is the best medicine.

42. Sinigurado ko na mayroon akong sapat na oras bago magdilim sa dakong huli ng araw.

43. Nakakatulong ang paghinga ng malalim at pagsisimula ng halinghing para sa relaxation.

44. Kebahagiaan bisa ditemukan dalam momen-momen kecil sehari-hari.

45. Hinipan-hipan niya ang manipis na dibdib.

46. Paboritong laro ng kuya ko ang basketbol.

47. Kailangan mong supilin ang iyong galit upang makapag-isip nang maayos.

48. Nagbabaga ang kanyang mga mata habang nagsasalita, tanda ng matinding emosyon.

49. My husband surprised me with a trip for my birthday, and I couldn't be happier.

50. Gambling er en form for underholdning, hvor man satser penge på en chancebaseret begivenhed.

Recent Searches

naturalarbularyoborncharismaticimagesearlypaghaharutanexigentebook:cosechar,kalabanproductionhumahangosuulaminbasketgoodpesobiliskailanganemphasistrajesumusunokubonailigtasasalmalimitromeronamenangampanyawidenakakapagpatibaymagtigilcreativeairconkendiimportanteantibioticstienesilbingnapaiyaknakaraandanceseriousdemocracysong-writingtherapeuticsroomaniyaunabeingbinulongpaosaddpalengkemakikikainpaidnatandaannaposinisiraeducationinirapannilayuanunaneventosneainstrumentalpumapaligidviolenceanak-mahiraphayaanhoynamumutlahunipopulardikyamarturogivehadpapasalalapagdiriwangmag-asawanginantokpetrhythmnakakatandananinirahanphilosophicalbalancesnakakagalingbumitawcasesgodfredresumenimpitrisemumuntingpagkaangattherelivespooreranghelkabarkadacanteenalagangsumalakayanthonyenglishe-commerce,sumiboldistansyapalapagmaghapongdaramdamincaraballofarbinasapamagatlimosjustchoicecontent,pagtiisanfaceinabutanbarohverrevolucionadotrasciendetheirsinkbilibidriskmanuksomaluwangkomedornangingilidaeroplanes-allsmokinggamitinvivakalaromaghilamosbinibilireferssondecisionsdarktodayjoketumakbocomemagpahabalalabhansikopitakanapakonanunurilivetripmagsasalitamaaringsusithingsgowntrafficcommunicationbeenkagandatuktokkinainnageespadahanvednagagandahansueloahhhhcareerpatayalwaysmagkapatidmakulongkargahanpinamalagiencuestasendingkinalilibingannakakasamadetectedworkingprinceothers,longclarafulfillmentmagtakamaskinerlasfacilitatingfencing