Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. The uncertainty of the situation has made it difficult to make decisions.

2. Napakalaking ahas ang nakita ni Anjo.

3. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil ito ay maaaring maging dahilan ng depresyon at iba pang mental health issues.

4. Ang tubig-ulan ay tumutukoy sa ulan na mayaman sa tubig at mahabang tagal.

5. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

6. La pobreza puede ser un círculo vicioso que se transmite de generación en generación.

7. Nag-iisa kasing anak si Ranay.

8. Marami ang botante sa aming lugar.

9. Ang pagiging aware at vigilant sa paligid ay mahalaga upang maiwasan ang pagkalat ng droga sa lipunan.

10. Nangyari pa nagmistulang itong reyna kung utusan ang ama at ina.

11. There are a lot of opportunities to learn and grow in life.

12. Eh bakit nakalock ha?!!! Explain mo nga!

13. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

14. Saan ho ba ang papuntang Manila Hotel?

15. When in Rome, do as the Romans do.

16. Hockey has produced many legendary players, such as Wayne Gretzky, Bobby Orr, and Mario Lemieux.

17. Mahirap magsalita nang diretsahan, pero sana pwede ba kita ligawan?

18. "Ang taong nagigipit, sa patalim kumakapit" ay isang bukambibig na nagpapakita ng kakayahan ng tao na gumawa ng mapanganib na mga hakbang kapag sila ay nasa kritikal na sitwasyon.

19. A couple of candles lit up the room and created a cozy atmosphere.

20. Namnamin mo ang halik ng malamig na hangin sa umaga.

21. Throughout the years, the Lakers have had fierce rivalries with teams such as the Boston Celtics and the Los Angeles Clippers.

22. Uy, malapit na pala birthday mo!

23. Sa pagtulong-tulong ng mga taga-komunidad, nagkaroon kami ng mas maayos na sistema ng basura.

24. Oh sige na nga sabi mo eh. hehe.

25. Hindi mo aakalaing maarte siya sa mga damit dahil hindi naman ito halata.

26. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

27. ¿Cuándo es tu cumpleaños?

28. "Dogs are not our whole life, but they make our lives whole."

29. Electric cars, also known as electric vehicles (EVs), use electricity as their primary source of power instead of gasoline.

30. The job market and employment opportunities vary by industry and location.

31. Una de las obras más conocidas de Leonardo da Vinci es La Mona Lisa.

32. Nang magretiro siya sa trabaho, nag-iwan siya ng magandang reputasyon bilang isang tapat at mahusay na empleyado.

33. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

34. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

35. She always submits her assignments early because she knows the early bird gets the worm.

36. The lightweight fabric of the dress made it perfect for summer weather.

37. La música alta está llamando la atención de los vecinos.

38. Nabigla ako sa tanong nya kaya sinapak ko sya.

39. Hindi sila masiyado nakapagusap dahil nagpaalam agad ang dalaga na kailangan na niyang matulog.

40. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

41. Les objectifs à long terme peuvent sembler écrasants, mais la division en tâches plus petites et plus gérables peut aider à maintenir la motivation.

42. The company had to cut costs, and therefore several employees were let go.

43. Sometimes I wish I could go back to a time when I didn't know so much about the world - ignorance is bliss, after all.

44. Ang hirap pigilan ng inis kapag may nagawa sa atin ng hindi maganda.

45. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

46. "A house is not a home without a dog."

47. Ang amoy ng sariwang ligo ay nagbibigay ng mabangong pakiramdam sa buong araw.

48. The bookshelf was filled with hefty tomes on a wide range of subjects.

49. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

50. The children eagerly lined up for their share of the birthday cake.

Recent Searches

ydelsercreditvarietymichaelpagkatipinangangakgawamaghatinggabifreedomsundeniableisinaraestadospabilikuligligdisensyoliligawanmakinangfiverrhagdanpublicitypalibhasasantosnapapikittagakhabitmatikmanlihimmaulitnalugmokbinatakstruggledmedyomalayangkasalanankulotlilyfarmmulighedernaiinitankoreaduoncommunityniligawanamotradeakongpunsoprincesamakatwidiatfsumakaybingibinulongmaitimmoodzoomgranmatindingmisaleoremainpiecesgrewreservationurimuliproveeeeehhhhmaaringasinlateboteadverselybokatacountriesworrymakilingatetsaamalimitfonotripmillionsbranchespasanghjemstedbilanginpagmamanehomadungisreadingfredsafeipongbehalfideaetomapapaislareddevelopmentaddingheftylasingknowledgecableuponcommerceevilprotestarelievedslavemagpa-picturebutihinggrinsagadxixskypeindustrybinatanghaydyipzookaaya-ayangnalalaglagnangampanyanagpapaniwalanagtutulunganrevolutioneretnagkasunognalalabiglobalisasyonbibisitanakakasamanangangahoycarsnaapektuhanpangungusapmagagawanaguguluhanmakakakaenpaghihingalonalagutannag-iisatiniklingpagpalitgalaantsonggonagbibigayanmagpakaramitig-bebeinteproduceebidensyabwahahahahahanaglulutokinalilibinganninanaishayaanglinggongguitarranakakainmariaherramientakamustatiniktsssfriendinfluencesamericancareernagdadasalbumaligtadpumulotnagbabalanakahainhouseholdpagsubokitinatapatmagkasakithelenamaligayakanayangtenidochristmaskaraokematandanggawingbilanggokamotegjortcashpaggawahumigaasawasumasakaynilayuanmejohugisilocosnico