Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. Leukemia can be caused by genetic mutations or exposure to certain chemicals or radiation.

2. Haha! I'd want to see you fall inlove tonight.

3. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

4. Bilang paglilinaw, ang pondo para sa event ay galing sa donasyon, hindi mula sa pondo ng paaralan.

5. Ilan ang computer sa bahay mo?

6. Ang kahirapan at kawalan ng trabaho ay kadalasang problema ng mga anak-pawis.

7. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

8. Kung alam ko lang na ganito kasakit ang magiging parusa ko

9. Coffee shops and cafes have become popular gathering places for people to socialize and work.

10. Ang sugal ay isang pampalipas-oras na aktibidad na may kaakibat na panganib ng pagkakabigong pinansyal.

11. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magpakasaya at mag-enjoy sa buhay.

12. Hinanap niya ang dalaga sa buong kagubatan ngunit hindi niya nakita.

13. El equilibrio entre la ingesta de calorías y la actividad física es importante para mantener un peso saludable.

14. Narealize ko sa dakong huli na mahal ko pa rin ang aking ex.

15. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

16. The acquired assets will be a valuable addition to the company's portfolio.

17. There were a lot of flowers in the garden, creating a beautiful display of colors.

18. Anong oras gumigising si Katie?

19.

20. Hvis du vil have en chance for at nå toget, skal du virkelig skynde dig. (If you want a chance to catch the train, you really need to hurry.)

21. Nagandahan ako sa pagtatapos ng libro.

22. May grupo ng aktibista sa EDSA.

23. Lifestyle changes, such as exercise and a healthy diet, can help to lower high blood pressure.

24. Pagpasensyahan na daw niya ito dahil iyon na lamang ang natitira niyang pagkain.

25. Nagkakaroon ng pagdiriwang sa Batangas tuwing ika-23 ng Hulyo sa pag-alala kay Apolinario Mabini.

26. This has led to increased trade and commerce, as well as greater mobility for individuals

27. Hindi dapat natin husgahan agad ang mga taong bukas palad sa kanilang buhay dahil baka sila pa ang tunay na maligaya.

28. The charity made a hefty donation to the cause, helping to make a real difference in people's lives.

29. Dala ng malakas na pagdidilim, mas lalong nahirapan akong makita ang daan pabalik sa tahanan.

30. Palibhasa ay madalas na masigasig sa pagtuklas ng mga bagong kaalaman at ideya.

31. Ang tarangkahan ay gawa sa matibay na kahoy at bakal.

32. Ang mga tulay sa aming bayan ay tinutukoy bilang mga mayabong na likuran na may bulaklak at mga halaman.

33. Kumaripas si Mario nang mahulog ang kanyang sumbrero sa kalsada.

34. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

35. Inialay ni Hidilyn Diaz ang kanyang tagumpay sa Diyos at sa kanyang pamilya.

36. Nagtitinda ang tindera ng mga prutas.

37. "Walang madali sa mundo, lahat ay pinaghihirapan," ani ng aking lolo.

38. Les systèmes d'intelligence artificielle peuvent être utilisés pour résoudre des problèmes complexes.

39. Sa bawat tagumpay, dapat tayong magpasalamat at magbigay ng pagkilala sa mga taong tumulong sa atin, samakatuwid.

40. Ginagamit ang salitang "umano" upang ipahiwatig na ang isang pahayag ay hindi pa tiyak at batay lamang sa sinasabing impormasyon mula sa ibang tao o ulat

41. Puwedeng dalhin ng kaibigan ko ang radyo.

42. Hay una gran variedad de plantas en el mundo, desde árboles altos hasta pequeñas flores.

43. Los héroes son capaces de superar sus miedos y adversidades para proteger y ayudar a los demás.

44. Ang mga hayop sa gubat ay naglipana din.

45. Hindi pa rin siya umaalis sa kinauupuang balde.

46. Pedro at Juan ang mga pangalan namin.

47. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

48. Ang pagkakaroon ng malalapit na kaibigan ay isang nakagagamot na karanasan.

49. Patuloy ang labanan buong araw.

50. Butterfly, baby, well you got it all

Recent Searches

varietydietipinagdiriwangbakasyonnaglalarolandimagesbecamestep-by-stepbinatidailydarkdingdingmaliksikasapirinhimutokcomunicarsebuhaypahahanapmagingsakyanindependentlykingklimasangayunpamanhapdidagatbarcelonatagsibolumabogbarkonag-eehersisyooffentligekatandaankaraniwangcryptocurrencypinakawalandepartmentplayedmatuklapherunderstageipinasyangpagkahapomisakauntikapainkapatawaranspecialbokfuranak-pawisgumigitikantobayawakarbularyoimpactedtelebisyonpagkakataongmahawaanisa-isarambutantinyluisakayomayabongkutohumanganabloggers,kabundukanmapaikotmindanaokaagawkidkirankastilakamukhadahan-dahantungkolnahihiloinihandabilaopagluluksasidoloveadikvivanag-uwienchantedernanframagalangscientifickumakalansingyumabongpinansinnararapatevenpalakadurantenalasingsiempreawitantinikartistspangitipantalopsumuothumihingalsumagottshirtlagaslaspalaytsegrammarbairdpopcorninantokcomienzanibaliktingdesdehitikginisingmakapag-uwiartificialbabababealsorepresentedcakenaisibigaynakapuntaincreasinglymuyaccuracyhvorexcuseitinaasmorningkonsentrasyoneducativasbasketballjennypamilyakailankeepingebidensyanaka-smirkbabaepunung-punonanaloschoolbahagyaestasyonmagsabisahodenergy-coalmamiideyamaalogkapaligiranstruggledperformanceamazonnagitladiedlugawmukahnag-emailvariouskaano-anomahahawatilalananag-umpisaellanaibabatemparaturabusogsanapawiswalangmalusogjanganangnotjobsnaiinispumilicountrieshydelsalamangkeroflightkawalinternacionalsteamshipsitems