Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. Nang mabangga ang kotse, kumaripas ang driver para umiwas sa responsibilidad.

2. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

3. The wedding photographer captures important moments and memories from the wedding day.

4. Ikinagagalak ng buong komunidad ang pagbubukas ng bagong paaralan sa kanilang lugar.

5. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

6. Tumango siya at nagsimula nang kumaen.

7. Habang naglalakad sa park, pinagmamasdan niya ang mga puno na sumasayaw sa hangin.

8. Nasa silid-tulugan ako at nagitla ako nang biglang bumukas ang bintana sa malakas na hangin.

9. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

10. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

11. Dali na, ako naman magbabayad eh.

12. Duon nakatira ang isang matandang babae at ang kanyang apo, isang binatilyo.

13. Tumamis at sumarap ang lasa ng bunga.

14. Sa gitna ng kalsada, ang nagdudumaling kotse ay maingat na dumadaan sa intersection.

15. Sana, binigyan mo siya ng bulaklak.

16. Paano ho ako pupunta sa palengke?

17. Ese comportamiento está llamando la atención.

18. Gusto ni Itay ang maaliwalas na umaga habang umiinom ng kape.

19. Tengo dolor de garganta. (I have a sore throat.)

20. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

21. Napansin ng kanyang mga kaibigan na maramot siya sa pagpapakita ng emosyon.

22. Ibinigay ko ang aking karanasan upang matulungan ang aking mga kababayan na nangangailangan ng tulong.

23. The number of stars in the universe is truly immeasurable.

24. Madalas lang akong nasa library.

25. Hospitalization can increase the risk of developing infections, and patients may be isolated or placed in quarantine if necessary.

26. La creatividad es una habilidad que se puede desarrollar con la práctica y el esfuerzo.

27. Hinde ko dala yung cellphone ni Kenji eh.

28. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

29. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

30. She watched a series of documentaries about the history of ancient civilizations.

31. Nahantad ang mukha ni Ogor.

32. Though I know not what you are

33. Diving into unknown waters is a risky activity that should be avoided.

34. Kaagad namang nakuha ng mangangahoy ang kanyang palakol kaya't nasugatan nito ang tigre sa leeg nito.

35. Magkano ang arkila kung isang linggo?

36. Ang tubig-ulan ay maaaring magdulot ng pagkakatanggal ng mga katas ng lupa at kemikal, na maaaring magdulot ng polusyon sa mga ilog at lawa.

37. Chris Paul is a skilled playmaker and has consistently been one of the best point guards in the league.

38. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

39. Overcoming frustration requires patience, persistence, and a willingness to adapt and learn from mistakes.

40.

41. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

42. Pinakamatunog ang tawa ni Ogor.

43. Ikinagagalak kong makita kang masaya sa bagong kabanata ng iyong buhay.

44. Ang pagbisita sa isang silid-pahinga o spa ay nagbibigay sa akin ng isang matiwasay na karanasan ng kalinisan at kaginhawaan.

45. He has bought a new car.

46. Where we stop nobody knows, knows...

47. Let the cat out of the bag

48. I just launched my new website, and I'm excited to see how it performs.

49. May mga taong naniniwala na ang digmaan ay hindi ang solusyon sa mga suliranin ng mundo.

50. Limitations can be a result of societal or systemic inequalities and discrimination.

Recent Searches

varietykaraniwanglongpagsalakaypaslitsandokngunitkahitparaanlalawigankumainasignaturaprocessesnagkakakainspecialnagpagawapinagmamasdanmagturotambayanpalagidiyoshinahanaplulusogkaysaorasownnotrailwaysmasayang-masayangpatuloykinayanagbiyayamahabaibabaarbejdersangkapmahabangsinampaliniibigpagkakatuwaanmayabonghayoptagalkahusayanlegislationscottishnagbabalakatabingpagkamanghahimutokchangednagtungonagtatakangkasamamahalkanyamahalagananlalamigdonemahigpitskillsiyomahihirapbusinessesnatinmasyadogooglemarumimusmosditokuwartongmorekahoymahinangdertalawownagre-reviewdioxidetingingtayobalakmakapagempakeshopeemabaitnagtanghaliantubig-ulangawainggabimarangyangkasingnagtataaspaliparinoperahanyeyrepublicdailyacademysarisaringdalagangbasketlamangubosakimenergy-coalpagodmagisinginilagaynagsasanggangmasamaibanawalamagandangmahuhusaymagpapabakunaniyadiednegativegulathadnagkakasayahanfouraksiyonmitigateupangparabahay-bahayantawagtulogmaibibigayipagtanggolmaicounti-untinangingilidmanonoodmatalinomaidmaihaharapmarinigsoundnagwalispamahalaansolartoysexhaustionsaranggolaanyohabangulapbahagyangcreatedkagubatanbilihinilannakalabasopportunitiespabalingatmaingaycnicopagkakahawakbatapronounpamilihankasamaangnegro-slavessummitmainitdapit-haponpamamagitanmasayangsakinmagtiwalamaintainlovekaratulangsorpresagayunmanpangulobastaunderholderlitoekonomiyamaipagmamalakingmagkabilangmaipapautangpakikipagtagponapapalibutanmaistorbosinonakikilalangmaisusuotrizalmagsasakamaliligomamayagurobinigyangcashninatawad