Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

2. Have they visited Paris before?

3. Wasak ang kanyang kamiseta at duguan ang kanyang likod.

4. Sang-ayon ako na kailangan nating magkaroon ng malakas na liderato upang umunlad ang ating bansa.

5. Ikinakagalit ko ang mga sakim na minahan.

6. Ayaw niya ng maarte at mataas na presyo kaya lagi siyang nagbabakasakali sa mga mababang halaga.

7. Doon nila ipinasyang mag honeymoon.

8. Les enseignants peuvent participer à des formations continues pour améliorer leurs compétences pédagogiques.

9. Smoking can be addictive due to the nicotine content in tobacco products.

10. Pwede mo ba akong tulungan?

11. Doa juga bisa dijadikan sarana untuk memohon kesembuhan dan keberkahan atas orang yang sakit.

12. The internet is full of fashion blogs. They're a dime a dozen.

13. Les personnes âgées peuvent continuer à poursuivre des activités et des hobbies qu'elles aiment.

14. Air susu dibalas air tuba.

15. Tumama ang siko nito sa kanyang dibdib, sa kanyang katawan! Dali-dali siyang tumalikod at patakbong lumabas.

16. Tumawa nang malakas si Ogor.

17. Håbet om at opnå noget kan motivere os til at tage skridt for at nå vores mål.

18. We were trying to keep our engagement a secret, but someone let the cat out of the bag on social media.

19. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

20. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

21. Paano ako pupunta sa Intramuros?

22. Many cultures have traditional sweet treats, such as baklava, churros, and mochi.

23. L'intelligence artificielle peut aider à améliorer les traitements médicaux et les diagnostics.

24. Bilang paglilinaw, hindi ako nagbigay ng pahintulot sa pagbabago ng plano.

25. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

26. We have been cleaning the house for three hours.

27. El nacimiento de un bebé puede tener un gran impacto en la vida de los padres y la familia, y puede requerir ajustes en la rutina diaria y las responsabilidades.

28. Frohe Weihnachten! - Merry Christmas!

29. Nag-aaral tayo ng Tagalog ngayon.

30. The dedication of parents is evident in the love and care they provide for their children.

31. Maaliwalas ang simoy ng hangin sa probinsya.

32. Ah miss, tanong lang... Iyo bang lahat yan?

33. Emphasis is an important tool in public speaking and effective communication.

34. Hinde mo pa nga pinapatapos yung sasabihin ko eh.

35. Maliit ang telebisyon ng ate ko.

36. Kapag mayroong mga proyektong mahirap, pinagsisikapan ng mga manggagawa na matapos ito ng maayos.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Diyos ko, ano po itong nangyayari sa aming anak?

39. I am not teaching English today.

40.

41. Saya tidak setuju. - I don't agree.

42. Hawak nito ang isang maliit na bangos na tig-bebente, sa loob-loob ni Aling Marta.

43. Gusto kong hiramin ang iyong cellphone para tawagan ang aking kaibigan.

44. Malalaki ang ahas na nakakulong sa zoo.

45. Hindi ko alam kung paano maaalis ang aking mga agam-agam sa aking kinabukasan.

46. Ang mga anak-pawis ay nangangailangan ng patas na pagkakataon upang magkamit ng tagumpay at umangat sa buhay.

47. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

48. The website has a section where users can leave feedback and suggestions, which is great for improving the site.

49. Sa mga lugar na malapit sa ilog, ang mga punong-kahoy ay nakakatulong sa pagpapabuti ng kalidad ng tubig.

50. Bilang paglilinaw, hindi ako nagsabi na aalis ako, kundi lilipat lang ako ng departamento.

Recent Searches

varietynabalitaanbaglivetag-arawsourcespuntahanmaipagmamalakingmagalangmaka-alisnakakitanagwo-workedukasyonnagawanghinding-hindipumatolmodernemarketplacesamongbalediktoryanpagpapakilalahacernagtatampongitimagkaharapbiglauniquematatagnapakabutilumuhodklimakananinilalabashomeworkhinahanapcramebitawanbagongnakatingingmasipagantesnagmasid-masidmansanaskinapanayamimportantekahuluganinsektonghealthierdonamountnag-aalaysang-ayonagospisopanatagmatulogmanagerlimoscanteensunugindamitbulongmagingmagkasabaymag-asawangmatapobrenginsidentekawalpagpasokarbularyoreviewersrimasnangapatdanlanapakikipagbabagdelaisamanaghinalaengkantadangimporrabbanakatanggapmagbabalaejecutarinompinangyarihannagdiretsoscalenawawalaibinigaymahirapnyangpintuanalinpatingupworkvegasactingbecomesibonkatapatbabaeuuwitinginnakuhaikinatuwataun-taonginangitinatagbahagimagbasapa-dayagonalnaubostaposlabimahinahongnakayukoiwinasiwassinunggabanmaalikabokpetsamananaigtuluy-tuloymainithamakkaibiganlibongabstainingkulangpierprinsesapinadalakaparehabaropagapangmatustusanmahabageneratelagibook,tuyotpinalitankikilostagalabakisameligawannasugatanpisarahahatolnagtagalhumanssuccessgalingpamilyaposterparinmag-anakproductionothers,nanghingininaisdownpaanannatulalaibigaysamakatuwidhiwagaconstantsiglakaawaytalentedwerepagsagotlawaypangethumiwalayschoolssayoanak-pawismatalikpagoddumapaanothercreatingparticularmakamitpaaralancedulapageantihandamatasearchbabaerohangganglintaleadpresidentemag-aaralkaraniwangbuwan