Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. I need to check my credit report to ensure there are no errors.

2. Sa dakong huli, mas pinili ko pa rin ang magsinungaling kaysa sabihin ang totoo.

3. Nakikihukay siya ng mga halamang ugat at namumulot ng tirang pagkain.

4. Sino ang kasama niya sa trabaho?

5. La labradora de mi vecina siempre ladra cuando alguien pasa por la calle.

6. Umalis sa sakayan ang mga pasahero nang limahan.

7. Nakakainis ang mga taong nagpaplastikan dahil hindi mo alam kung totoo ba ang sinasabi nila.

8. Huwag mo nang papansinin.

9. Kailangan ko munang magpahinga para mawala ang inis ko.

10. Gusto ko magpahinga sa tahimik na lugar.

11. May natagpuan umanong bagong ebidensya sa kaso ng pagkawala ng bata.

12. Magtiis ka dyan sa pinili mong trabaho.

13. Ano ang ginawa ni Tess noong Marso?

14. Las heridas en niños o personas mayores pueden requerir de cuidados especiales debido a su piel más delicada.

15. Nationalism often emphasizes the importance of a common language, culture, and history.

16. Ano ang kulay ng mga prutas?

17. Bagama't mabait ay mailap ang hayop na ito dahil sa hiya.

18. Automation and artificial intelligence have further improved transportation, making it safer and more efficient

19. Beyoncé is a highly acclaimed singer, songwriter, and actress known for her powerful performances and chart-topping hits.

20. The first dance between the bride and groom is a traditional part of the wedding reception.

21. Bakit lumilipad ang manananggal?

22. Magdamagan silang nagtrabaho sa call center.

23. Nag smile siya sa akin tapos tumango.

24. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

25. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

26. Ano ang kulay ng libro ng kaklase mo?

27. Nagreport sa klase ang mga grupo nang limahan.

28. Hindi ako nakatulog sa eroplano.

29. Kucing dikenal dengan sifatnya yang lucu, manja, dan lincah.

30. Umuwi na ako kasi pagod na ako.

31. May mga pagkakataon na kinakailangan mong hiramin ang isang sasakyan para sa long-distance travel.

32. The restaurant didn't have any vegetarian options, and therefore we had to go somewhere else to eat.

33. Merry Christmas po sa inyong lahat.

34. Madalas na may agam-agam sa buhay ng mga estudyante tuwing magkakaroon ng exam o project submission.

35. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

36. Ang pagpapahinga ng isip at katawan sa pamamagitan ng meditasyon ay nagdudulot ng isang matiwasay na kalagayan.

37. The company's acquisition of new assets will help it expand its global presence.

38. Lord, Wag mo muna siyang kunin..

39. Kailangan ko ng bumalik sa aming kaharian dahil kung hindi ay hindi na tayo muling magkikita pa.

40. Hay muchos riesgos asociados con el uso de las redes sociales, como el acoso cibernético.

41. Walang anak sina Mang Kandoy kaya't ganoon na lamang ang dasal nila sa Panginoon upang mabigyan sila ng anak.

42. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

43. The project is taking longer than expected, but let's hang in there and finish it.

44. Maiiwasan ang bungang-araw kung paliligo nang regular.

45. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

46. Tatlong araw bago dumating ang ikatlong Sabado, sorpresa ko siyang dinalaw.

47. Sa pagdiriwang ng fiesta, ang bayanihan ay nagiging mas makikita sa paghahanda at pagdaraos ng mga aktibidad.

48. Nang dumalaw muli ang kanyang ama, pinatawad na niya ito at maging ang kanyang ina ay tuluyang gumaling at napatawad pa rin ang asawa.

49. The weatherman said it would be a light shower, but it's definitely more like it's raining cats and dogs.

50. Ininom ni Henry ang kape sa kusina.

Recent Searches

varietymaligayahelenamataaastatlomaramotparurusahanpublishing,dreamskayapinyapropensobutihingayangenerationsoverviewcontinuestructureipinalutosilyakaaya-ayangpsssexhaustedgasmahuhusaynegroseffort,alagangnutrientsbarung-barongpinagtagposponsorships,maglalaronakahigangmeriendamusiciangabi-gabiaktibistanagawangpinaliguanmakidalominu-minutodekorasyonpandidirinakabawimakakakaenpagpanhikmagpapagupitnahahalinhanmaasahanpananglawnapatulalamananalonaghubadpagiisipkinakabarkadaipinambilikastilaoperativosnagyayanginilabasjackzbumabagnuhtuvomarangyanginfluencesfireworkstryghedpakainneavotespakpakprobablementegabepatrickipinalitlibagsutilngpuntapa-dayagonallutuinpanghihiyangkinikilalangmakasalanangnasasakupannakakabangonnovellescitizensnakangisiaraw-arawnakapangasawapaghihingalomagpagalingmasaksihancourtkapasyahanbulalaspagbigyanamericafitnesshinahanapnatatawagospelnilaosinstrumentalmabagalhinahaplospadalasminerviedibaejecutantagakmaghatinggabimournedbingozoorefersnahulisinapakremainbinabamichael4thhardreturnedinvolveissueslinggongkailangangipinatutupadpagkaimpaktoperfectambisyosangpioneerdiretsahangrebolusyonpaglalabadakarununganmakatatlonailigtaspangungusappagkabiglanakapasadaliuniversitycultivationngumingisinaghihirapipinansasahogrimasmabigyanlumusobtelebisyonhimayineducationpangilkerbmachinesgigisingbisikletamamarilcandidateswayschamberstuwidtulangmatesatulalapumatolbasahinmalambinglutorosaiguhittinanggapkagayapyestacoaching:guiltyformflyjuniotutorialssyncmethodsedit:conditionprovealamlawaynatupadnagiislowmestnakagalawtatawaglabing-siyamculturalkalabaw