Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

36 sentences found for "variety"

1. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

2. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

3. Consuming a variety of fruits and vegetables is an easy way to maintain a healthy diet.

4. Dogs can be trained for a variety of tasks, such as therapy and service animals.

5. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

6. Healthy eating should include a variety of proteins, carbohydrates, and healthy fats.

7. Investors can invest in a variety of asset classes, such as stocks, bonds, real estate, and commodities.

8. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

9. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

10. She enjoys cooking a variety of dishes from different cultures.

11. Some coffee enthusiasts enjoy collecting different types of coffee beans and brewing methods to explore the variety of flavors and aromas that coffee has to offer.

12. Sweetness can be found in a variety of foods and beverages, such as candy, soda, and fruit juice.

13. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

14. The art class teaches a variety of techniques, from drawing to painting.

15. The bakery offers a wide variety of cakes, from classic flavors to unique creations.

16. The beach has a variety of water sports available, from surfing to kayaking.

17. The beauty store has a variety of skincare products, from cleansers to moisturizers.

18. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

19. The clothing store has a variety of styles available, from casual to formal.

20. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

21. The conference brings together a variety of professionals from different industries.

22. The exhibit features a variety of artwork, from paintings to sculptures.

23. The festival showcases a variety of performers, from musicians to dancers.

24. The garden boasts a variety of flowers, including roses and lilies.

25. The grocery store offers a variety of fresh produce, including fruits and vegetables.

26. The internet has also led to the rise of streaming services, allowing people to access a wide variety of movies, TV shows, and music

27. The library has a variety of books to choose from, ranging from classics to modern literature.

28. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

29. The music playlist features a variety of genres, from pop to rock.

30. The park has a variety of trails, suitable for different levels of hikers.

31. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

32. The sports center offers a variety of activities, from swimming to tennis.

33. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

34. The store has a variety of sizes available, from small to extra-large.

35. The store offers a variety of products to suit different needs and preferences.

36. The zoo houses a variety of animals, including lions, elephants, and giraffes.

Random Sentences

1. Kailangang magluto ng kanin ni Pedro.

2. Twitter has a set of rules and policies to govern user behavior, including guidelines against hate speech, harassment, and misinformation.

3. Hindi rin niya inaabutan ang dalaga sa palasyo sa tuwing dadalawin niya ito.

4. Wag na, magta-taxi na lang ako.

5. Mahirap magsalita nang diretsahan, pero ito na - crush kita.

6. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

7. Ang buntot ng saranggola ay mahaba at makulay.

8. Tinulungan ko siyang dalhin yung mga plato sa dining room.

9. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

10. Hindi na maawat ang panaghoy ng matanda nang makita ang nasirang bahay.

11. Håbet om en bedre fremtid kan give os motivation til at arbejde hårdt.

12. Sino ang kasama niyang nagbakasyon?

13. Anong hindi? Eh pulang-pula ka na oh!

14. ¿Cómo te va?

15. Agad na ginamot ni Mang Sanas si Nam at nawala ang lahat ng kaniyang mga sakit at sugat.

16. Elektronik kan hjælpe med at forbedre adgangen til information og vidensdeling.

17. Magkita tayo bukas, ha? Please..

18. Ano ang ikinatatakot ng mga tao sa bagyo?

19. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

20. Nakuha ko ang aking inaasam na sapatos kaya masayang-masaya ako ngayon.

21. Sinabi umano ng saksi na nakita niya ang suspek sa lugar ng krimen.

22. Investing in the stock market can be risky if you don’t do your research.

23. The influence of a great teacher on their students is immeasurable.

24. May notebook ba sa ibabaw ng baul?

25. ¡Muchas gracias por el regalo!

26. Ang daming bawal sa mundo.

27. Dahan dahan akong tumango.

28. Puwede ba kitang ibili ng inumin?

29. Ilang beses ka nang sumakay ng eroplano?

30. Ma, wag mo akong iwan. Dito ka lang ma!

31. Nais nating makamit ang ating mga pangarap upang magkaroon tayo ng mas magandang buhay.

32. Samantala sa pamumuhay sa probinsya, natutunan niyang mas ma-appreciate ang kagandahan ng kalikasan.

33. I have graduated from college.

34. Masaya akong napanood ko na live ang pagkanta ng Bukas Palad sa isang fundraising event.

35. Si Maria ay malakas ang boses, bagkus ang kanyang kapatid ay tahimik.

36. Nagpapadalhan na kami ng mga mensahe araw-araw dahil nililigawan ko siya.

37. O-order na ako. sabi ko sa kanya.

38. Hindi ko mapigilan ang aking mga titig sa aking nililigawan dahil sobrang ganda niya.

39. Ngumiti siya ng malapad sabay hagikgik.

40. Tumingin ito sa mga website ng mga bagay na pwedeng bilihin online.

41. Ibinili nya ng maraming diaper ang kanyang anak.

42. Napakalaki pala ng agila sa malapitan!

43. The widespread use of the telephone has had a profound impact on society

44. The elderly man was happy sitting on his porch, watching the world go by - sometimes ignorance is bliss in old age.

45. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

46. Pumitas siya ng isang bunga at binuksan iyon.

47. Ang edukasyon lamang ang maipapamana ko sayo.

48. Sweet foods are often associated with desserts, such as cakes and pastries.

49. In conclusion, Elvis Presley was a legendary musician, singer and actor who rose to fame in the 1950s and continues to influence the music industry and American culture till this day

50. Marami ang nahuhumaling sa larong mobile legends.

Recent Searches

varietymabangispinagsasasabikaano-anokasoyshipsinasakyanteachkatamtamanskypenaniniwalaforcesmalungkothanapbuhaymakasarilingidinidiktaitinuturingmababangispasasalamatunderholdergayundinmalapitanbuenahealthprosperdivisoriavelfungerenderisktatayotripganidneverpaki-chargetinigilhapdithereforelibreespadavisshouldmindanaonagmungkahijustgospelnangapatdanendreservedfremtidigedalapinalalayasjenashapingkruspaglalabaraisebookstag-ulanumingittalagangkotseinspirasyonmaglinisdespitenahulogtssspagpapasakittowardsmaisipwalasinaliksikpamimilhingh-hindimaaaringundeniablekinumutantilakusinerosawamakakalimutinkailanganlihimubos-lakashalamanklasenaghuhukaypesoskakaininsiyakamirevolutionizedeffektivganangmatabanakonsiyensyatuladsimbahanerhvervslivetbreaksapatossinundanregalomakinghalamangfollowinglikaspinaglagablabitinalikunwapumikitsimulahuwagmapagkatiwalaannag-isipbaskettagilirancommunityhomepagkalungkotyakapinsupilincuredtinitirhannag-emailimeldadiyosbuwantinysumugodtonyhulingmakuhaskillsmagkapatidneed,nag-uumiriaga-agaricacornerssilaygupitkuwartatumalimpunongsensiblepumilipulongpiecessenadorpansolagospalangbrasosaidpollutionngusopagamutanibongrammarhumahangospagkatakotblognapatulalamagingsobratumabakarnabalinilabasbinatilyongnapakalakasinakalamalezastrugglednangingitngittumaloninspirednakakaakitawtoritadongnatigilangmediaagam-agamsignificantbarneshadhayopdadadoonmustmataloitsuraluhacapitalistpatientkalawangingwaitwaysdiplomathingnapalakasbeyonddreams