Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "economic"

1. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

2. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

3. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

4. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

5. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

6. Nationalism can have a positive impact on social and economic development.

7. Starting a business during an economic downturn is often seen as risky.

8. The company's profits took a hefty hit after the economic downturn.

9. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

10. The market is currently facing economic uncertainty due to the pandemic.

11. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

12. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

13. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

14. The United States is the world's largest economy and a global economic superpower.

15. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Bawal magdadala ng baril sa loob ng paaralan dahil ito ay delikado sa kaligtasan ng mga estudyante.

2. Muchas personas pobres no tienen acceso a servicios básicos como la educación y la atención médica.

3. Women have diverse experiences and backgrounds, including those based on race, ethnicity, and sexual orientation.

4. Huh? umiling ako, hindi ah.

5. Inilagay nya sa poon ang biniling sampaguita.

6. Makabalik na nga sa klase! inis na sabi ko.

7. Ang daming labahin ni Maria.

8. Mula sa pagiging simpleng atleta, si Hidilyn Diaz ay naging simbolo ng determinasyon at tagumpay.

9. Ang mga hardin sa mga pribadong sityo ay ipinapalagay na mayabong at nag-aalok ng kaginhawahan.

10. Kinakabahan ako para sa board exam.

11. Nagsayaw sa entablado ang mga mag-aaral nang limahan.

12. Limitations can be perceived or real, and they can vary from person to person.

13. Les visites sont souvent autorisées à l'hôpital pour soutenir les patients pendant leur convalescence.

14. It's nothing. And you are? baling niya saken.

15. Las redes sociales también pueden ser una herramienta para hacer campañas de concientización y recaudar fondos.

16. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

17. Hindi ka puwedeng pumasok sa unibersidad.

18. Ahhhh ok. Ilan ba ang kapatid mo? tanong ko.

19. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

20. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

21. The waveform displayed on an oscilloscope can provide valuable information about signal amplitude, frequency, and distortion.

22. Ilang beses ka nang sumakay ng eroplano?

23. Sadyang mahirap ang pag-aaral ng calculus.

24. Mie goreng adalah mie yang digoreng dengan bumbu-bumbu khas Indonesia hingga terasa gurih dan pedas.

25. Scientific evidence has revealed the harmful effects of smoking on health.

26. Nasa loob ng bag ang susi ko.

27. He has written a novel.

28. Saan ho ba ang papuntang Manila Hotel?

29. Lazada's influence on the e-commerce industry in Southeast Asia is significant, and it is likely to continue to be a major player in the years to come.

30. S-sorry. nasabi ko maya-maya.

31. Les personnes âgées peuvent bénéficier d'un régime alimentaire équilibré pour maintenir leur santé.

32. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

33. Takot siyang salatin ang sahig dahil sa maaaring may ipis.

34. They are not attending the meeting this afternoon.

35. In conclusion, technology has had a profound impact on society, shaping the way we live, work, and interact with one another

36. Maraming bayani ang nagawa ng mga bagay na imposible sa panahon ng kanilang panahon.

37. Bilang paglilinaw, ang impormasyon ay nakuha mula sa opisyal na website, hindi sa social media.

38. Ang pagtatayo o pagsali sa isang komunidad o samahan ay nakagagamot sa aking pakiramdam ng pagka-bahagi at pagkakakilanlan.

39. Tila uulan ngayong hapon dahil sa madilim na ulap sa langit.

40. Mathematics helps develop critical thinking and problem-solving skills.

41. Habang naglalaba ang kanyang ina ay walang tigil namang naglalaro si Juanito.

42. Naghanap siya gabi't araw.

43. Binigyan niya ako ng aklat tungkol sa kasaysayan ng panitikan ng Asya.

44. Madalas itong nag ku-kwenta ng kanyang mga kinikita.

45. Microscopes can be used to study living organisms in real-time, allowing researchers to observe biological processes as they occur.

46. Ang mga dahon ng bayabas ay nagagamit din sa medisina.

47. During the holidays, the family focused on charitable acts, like giving gifts to orphanages.

48. The use of computers and the internet has greatly improved access to information and resources, and has made it possible for people to learn at their own pace and in their own way

49. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

50. Matagal-tagal na siyang tulala, hindi niya alam kung ano ang gagawin.

Recent Searches

economicfurycontestbilidivisionmag-asawangnuclearnamanghakerbbanawearawmahiyaipinadalapagpapatubotilgangpagkakayakapkundiituturosong-writingmakitabakemaximizingsoccerkawili-wililumangoynakasuotevenmobilenothingfurtherartificialrolledferrernakapilangnabuhaynapakabilismagsisimulasuzettemagtakaumagawprimerospalibhasanamataynakikitangpaki-drawingsharmainemagkaibanguugud-ugodmagpalibremensajesnaglalakadnagbakasyongobernadorchristmasnagtatampomadilimwalkie-talkienag-poutmakasilongtaun-taonnakuhangnagliwanaghinihintaybeautifulnaawarewardinghalinglingisusuotminatamisafternoonunconventionalnakakapuntapangalananmakatimaskaramagtanimmaisipmatayogimbeskasishoppingsayamagsunogmatabangnetflixtibigproudpaldaumakyaticonicalaalalandeanywheretambayanpigingnamanreachiniwannunolandotrendangerousminu-minutosinapakebidensyanamuhaysamakatuwidnaririnignilinissumamadagaabalagamotmodernenviarexampleneedsayanthreepilingmereechavespecialgabi-gabinungteamconsiderarinalalayannutrientesrose1973jerrymarahilbutinhalehomesdireksyontayoeveningpamumunonaroonkanilanagtitindamakikitanag-aalaytupelokatutubomayakaptsssbatalanfatalalmacenarkinaumilinglimasawalapiskubyertoskulunganmananaogsistemasmaidpalayanmahabolnyansamahantinanongtinaasanthoughtsjerometalentedtalagangtaglagastagaytaytagalabasumusunosumingitsumandalmakalaglag-pantysugatangstudentssquattersoftwareskyldes,kaparehasisipainbaosisidlansinundansinisirabansangsinipangsingsingsinampalsimplengsimbahansiksikanserviceskaloobangsawsawansasakyan