Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "economic"

1. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

2. Economic recessions and market crashes can have devastating effects on investors and the broader economy.

3. Environmental protection can also have economic benefits, such as creating jobs in sustainable industries.

4. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

5. His presidency saw significant economic growth before the pandemic, with low unemployment rates and stock market gains.

6. Nationalism can have a positive impact on social and economic development.

7. Starting a business during an economic downturn is often seen as risky.

8. The company's profits took a hefty hit after the economic downturn.

9. The distribution of money can have significant social and economic impacts, and policies related to taxation, wealth distribution, and economic growth are important topics of debate.

10. The market is currently facing economic uncertainty due to the pandemic.

11. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

12. The United States also has a capitalist economic system, where private individuals and businesses own and operate the means of production

13. The United States has a capitalist economic system, where private individuals and businesses own and operate the means of production

14. The United States is the world's largest economy and a global economic superpower.

15. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Mas romantic ang atmosphere sa dapit-hapon.

2. Les programmes d'études sont élaborés pour fournir une éducation complète.

3. Cancer can have a significant financial impact on individuals and society, including healthcare costs and lost productivity.

4. Nakakapagtaka naman na hindi nya ito nakita.

5. Nagtalaga sila ng mga dibisyon kung saan maninirahan ang bawat hayop.

6. Cryptocurrency has the potential to disrupt traditional financial systems and empower individuals.

7. Pemerintah Indonesia menghargai dan mendorong toleransi antaragama, mengedepankan nilai-nilai kehidupan harmoni dan persatuan.

8. He is painting a picture.

9. Sampung minuto na lang bago mag-alas otso.

10. Time heals all wounds.

11. Mababa ang antas ng tubig sa dam, kaya nagpatupad ng water rationing.

12. Ang bayanihan ay nagpapakita ng kahalagahan ng pagtutulungan at pagkakaisa sa pagharap sa mga suliranin.

13. Si Hidilyn Diaz ay naging inspirasyon din sa iba’t ibang mga atleta sa buong mundo.

14. Think about what message you want to convey, who your target audience is, and what makes your book unique

15. Sa wakas, nangahas siyang sundin ang kanyang pangarap, anuman ang mga balakid na nasa kanyang harapan.

16. Kinasuklaman ako ni Pedro dahil sa ginawa ko.

17. Laging kinatatakutan si Kablan sa pagiging usurero sa Palawan, ang pating naman ay lagi ring kinasisindakan sa kabangisan.

18. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

19. Mawala ka sa 'king piling.

20. En España, el cultivo de la vid es muy importante para la producción de vino.

21. She opted for a lightweight jacket to wear during her morning run.

22. The website has a lot of useful information for people interested in learning about history.

23. La realidad puede ser sorprendente y hermosa al mismo tiempo.

24. Ano ang sinabi ni Antonio Tinio?

25. Ang pag-inom ng tsaa tuwing umaga ay isa nang ritwal na nagbibigay ng enerhiya sa kanya.

26. Übung macht den Meister.

27. Pakibigay sa akin ang iyong opinyon tungkol sa balitang nabasa mo.

28. Hindi ko inakala na magkakaroon ako ng ganitong pakiramdam, pero crush kita.

29. Crush kita alam mo ba?

30. My coworkers and I decided to pull an April Fool's prank on our boss by covering his office in post-it notes.

31. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

32. Tak kenal maka tak sayang.

33. Pumunta kami sa Laguna kamakalawa.

34. Nagliliyab ang mga damo sa bukid dahil sa sobrang init ng panahon.

35. El que busca, encuentra.

36. La agricultura sostenible busca minimizar el impacto ambiental del cultivo de alimentos.

37. She has started a new job.

38. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

39. Der er ingen grund til at skynde sig. Vi kan tage det roligt. (There's no need to hurry. We can take it easy.)

40. This has led to increased trade and commerce, as well as greater mobility for individuals

41. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

42. Maraming natutunan ang mga estudyante dahil sa magaling na pagtuturo ng guro.

43. Upang magpalago ng mais, kailangan mong magsimula sa pamamagitan ng pagpili ng tamang lugar para sa iyong halaman

44. He is not running in the park.

45. Facebook offers various features like photo albums, events, marketplace, and games to enhance user experience and engagement.

46. Masarap maglakad sa dapit-hapon dahil mas malamig na ang hangin.

47. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

48. Psss. napatignin ako kay Maico. Naka-smirk siya.

49. Fødslen kan også være en tid med stor frygt og usikkerhed, især for førstegangsforældre.

50. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

Recent Searches

economickatedralforståhikinghitiksparknaritodamitvedabstainingitimplayskahonplanenviarpersonsmagbubungabeforenanghihinamadmakapaibabawtabing-dagatkinatatalungkuangparticularcontent,dahilnagpaiyakmaihaharapdisenyongmirapakanta-kantangsalamangkerokasangkapannagpapaigibinvestvideos,nagmungkahipaghaharutanambisyosangkuwadernokalaunanimporkabundukantumutubonaiyakpinagkiskistreatsnanunurinakatitiginakalataglagaspagbabayadnakataaspagkaraamagbalikkwartopagdudugonakatindigrodonaisusuotnavigationtumatawaduniversitynasaantinahakmabatongnakahainnanaloumupohalinglingparusahansumasayawgagamitbintanapapayapropesorgawaingcultureshayopmartianpanatagtenidomaestraarturokaninarightsunangfreedomsnatatanawmaibataun-taonsalatinilagayamendmentsrememberedbobototibokipagmalaakipulongprobinsyacoughingnatuloybunutanmakamitbethpumapasokmisaeventssumabogpoloconnectingbranchfreemaispawisgivecapitaltoretecalciuminiintayiskedyulherramientautilizardiyoscaroltasasurroundingshanginpagkathelpedituturonapatingalaxixwarifauxcomputere,suotchildrenltodikyammejokagandamakahingibehalfitinuringcouldgeneratelightsbringbakemalapitatafatalhadangsapilitangfonoumiinitmarchmalinissinongpooknatingalaasinrestawanjackytrafficrhythmyeahbehaviorgitanasincludepublishedpracticesdoingsteeritlogmalakingaggressionnerissapoonmayamanshowsrenaiasamfundnakatulogwithouthabitlumikhanagsamapagtatakanagdudumalingnami-misscuentapagkalipasbukodnakipagtagisancultivarnatatawakaincuentan