Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "book"

1. A couple of hours passed by as I got lost in a good book.

2. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

3. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

4. Don't underestimate someone because of their background - you can't judge a book by its cover.

5. Format your book: Once your book is finalized, it's time to format it for publication

6. Has she read the book already?

7. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

8. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

9. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

10. I am not reading a book at this time.

11. I am reading a book right now.

12. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

13. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

14. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

15. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

16. Make sure to keep track of your sources so that you can properly cite them in your book

17. Many people think they can write a book, but good writers are not a dime a dozen.

18. Nag-book ako ng ticket papunta sa Ilocos.

19. Promote your book: Once your book is published, it's important to promote it to potential readers

20. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

23. She has finished reading the book.

24. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

25. The feeling of finishing a challenging book can be euphoric and satisfying.

26. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

27. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

28. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

31. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

32. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

33. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

34. Writing a book is a long process and requires a lot of dedication and hard work

35. You can't judge a book by its cover.

Random Sentences

1. Sa pagtulog, ang utak ay nagpapahinga at nagpaproseso ng mga impormasyon na natutunan sa buong araw.

2. Gusto kong mamasyal sa Manila zoo.

3. The dedication of mentors and role models can positively influence and shape the lives of others.

4. Then the traveler in the dark

5. Eh bakit nakalock ha?!!! Explain mo nga!

6. Oy bawal PDA dito! natatawang sabi ni Lana.

7. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

8. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

9. Nagsilabasan ang mga taong bayan.

10. I am absolutely certain that I locked the door before leaving.

11. The blades of scissors are typically made of stainless steel or other durable materials.

12. Los bebés pueden nacer en cualquier momento del día o de la noche, y algunas veces pueden llegar antes o después de la fecha prevista.

13. Let's just hope na magwork out itong idea ni Memo.

14. Si Aguinaldo ay kinikilala bilang isa sa mga pinakamahalagang bayani ng Pilipinas.

15. Habang nagtatanim sila, tinatangay ng hangin ang mga buto palayo sa lupa.

16. Tinangka niya itong pigilan ngunit huli na ng naabutan niya ang matanda.

17. Teka, pakainin na muna natin sila. ani Jace.

18. Il existe un certain nombre d'organisations et de programmes qui offrent de l'aide aux personnes luttant contre la dépendance au jeu.

19. Ang librong ito ay ukol kay mam Luisa na nagbigay inspirasyon sa kanyang mga estudyante.

20. Una dieta equilibrada y saludable puede ayudar a prevenir enfermedades crónicas.

21. Bukas ay pupunta kami sa isang medical mission.

22. Mahalagang maglaan ng sapat na oras sa pag-aaral upang magtagumpay sa buhay, samakatuwid.

23. Pinangunahan ni Emilio Aguinaldo ang proklamasyon ng kasarinlan ng Pilipinas noong Hunyo 12, 1898.

24. Ang mga ideya ni Rizal tungkol sa pagkakapantay-pantay, edukasyon, at pagkakaisa ay patuloy na nagbibigay-inspirasyon sa mga Pilipino.

25. TV can be used for educating the masses, for bringing to us the latest pieces of information audio-visually and can provide us with all kinds of entertainment even in colour.

26. Maasim ba o matamis ang mangga?

27. Pagkatapos, dapat mong i-mark ang mga lugar kung saan mo gustong magtanim ng mais at mag-plant ng mga buto sa mga ito

28. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

29. Pinakain ni Fia ang aso ng dog treats.

30. Malapit lang pala bahay niyo eh. akala ko naman malayo!

31. Ano ang ginawa mo para sa selebrasyon nyo?

32. Pumupunta kami sa sementeryo tuwing undas.

33. Paglalayag sa malawak na dagat,

34. She has excellent credit and is eligible for a low-interest loan.

35. Balak kong magluto ng kare-kare.

36. Niloloko mo ba ako? Ang lamig lamig pa eh!

37. Dali-daling umalis ang binata patungo sa palasyo.

38. Sa panahon ng tag-ulan, mahalaga ang mga punong-kahoy dahil nakakatulong ito sa pagpigil ng pagbaha sa mga lugar na may malalaking bundok.

39. La realidad a veces es cruel, pero debemos enfrentarla con valentía.

40. Ang bata ay takot na nakatingin sa kanya.

41. Huwag kang lalayo nang palayo sa amin para hindi ka mawala.

42. La conciencia nos ayuda a entender el impacto de nuestras decisiones en los demás y en el mundo.

43. Limitations can be a result of geographic location or access to resources and opportunities.

44. Cultivar maíz puede ser un proceso emocionante y gratificante, con una buena planificación y cuidado, se puede obtener una cosecha abundante

45. Dahil sa pagtaas ng populasyon sa bansa, yumabong ang pagtatayo ng mga condominiums at mga townhouses.

46. En invierno, los árboles pierden sus hojas y se vuelven caducos.

47. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

48. Kailangang pag-isipan natin ang programa.

49. Ipanlinis mo ng sahig ang basahan.

50. The website's social media buttons make it easy for users to share content on their social networks.

Similar Words

notebookNag-bookfe-facebookfacebookbookse-booksbook:book,

Recent Searches

bookdreamspaglapastanganhalagabilangguanwondernagpapaypayagehalatangbaonpitakadelguidetuwangsongswalongquekasalukuyannamamsyalinamindertubigthankwalanglupalopmatarikmakuhanglaslorenaworkingmusicianbilinmusicdescargarnilimasnagdaramdambiyasnabighaniosakaaaliskinalakihanshipbirdskamoteusolonglucykamalayanakokalupipinagmasdankaano-anopuedeumingitkindspadercreativefriendcramenahuhumalingtransportmidlerpulgadatayoalagapinatawadkaininnag-asaranfilmdiretsopamimilhinakingstarspalabastakenewsdatungbumabagelectedtatagaltoyshulinglarrypatuloypdabumalingcenterdoeseditorsong-writingpumitasheitinaasanpaglalayaghumiwanerissahatingstrategydonhenrynanahimikcontent,maarawanjokawawangnagpuntahancontent:kailanmanthroughindendahanlasinginulititinalipaguutostinapayvaccinesproudcomfortvocalhayopcashditolimoskaniyaahassinunud-ssunodstudytransporttinataluntonnakiramaytinginnapagtuunansapilitangpumuntanakaraanputollolapagemensiloganubayanpigaintrinastructuremasayanabigkasapatnaniniwalasmokedisyemprekabiyakkagayatrenpamilyaibahagibahaynilutowastenamainatakemakapagpigilshopeeyukobinasaibat-ibangdumagundongumanomatakalongupangindvirkningano-anosumasakitehehematustusanincreasemahulogaksidentegarciamananahiskysoportemayabongkatutubohumintolumangoygusting-gustosanamagbagong-anyojustinkasiyahanoscarmagingfrogtigillibagkayanagwelganananaginipyumakap