Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

35 sentences found for "book"

1. A couple of hours passed by as I got lost in a good book.

2. Don't assume someone's personality based on their appearance - you can't judge a book by its cover.

3. Don't dismiss someone just because of their appearance - you can't judge a book by its cover.

4. Don't underestimate someone because of their background - you can't judge a book by its cover.

5. Format your book: Once your book is finalized, it's time to format it for publication

6. Has she read the book already?

7. He might be dressed in casual clothes, but you can't judge a book by its cover - he's a successful business owner.

8. He might look intimidating, but you can't judge a book by its cover - he's actually a really nice guy.

9. Here is a step-by-step guide on how to make a book: Develop an idea: Before you start writing, it is important to have a clear idea of what your book will be about

10. I am not reading a book at this time.

11. I am reading a book right now.

12. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

13. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

14. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

15. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

16. Make sure to keep track of your sources so that you can properly cite them in your book

17. Many people think they can write a book, but good writers are not a dime a dozen.

18. Nag-book ako ng ticket papunta sa Ilocos.

19. Promote your book: Once your book is published, it's important to promote it to potential readers

20. Quiero ser escritor y publicar un libro algún día. (I want to be a writer and publish a book someday.)

21. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

22. Sa kasal, ang pagdadala ng mga panulat ay mahalaga upang masigurong makapagsulat ng matatalinong mensahe sa guest book.

23. She has finished reading the book.

24. The car might look old, but you can't judge a book by its cover - it's been well-maintained and runs smoothly.

25. The feeling of finishing a challenging book can be euphoric and satisfying.

26. The Jungle Book introduces Mowgli, a young boy raised by wolves, as he encounters various jungle animals and learns life lessons.

27. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

28. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

29. Think about what message you want to convey, who your target audience is, and what makes your book unique

30. This can include creating a website or social media presence, reaching out to book reviewers and bloggers, and participating in book signings and events

31. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

32. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

33. Writing a book can be a rewarding experience, whether you are writing for personal fulfillment or to share your knowledge and expertise with others

34. Writing a book is a long process and requires a lot of dedication and hard work

35. You can't judge a book by its cover.

Random Sentences

1. ¿Qué fecha es hoy?

2. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

3. Who needs invitation? Nakapasok na ako.

4. L'intelligence artificielle peut être utilisée pour identifier les anomalies dans les données pour prévenir les problèmes futurs.

5. Ang mabuting kaibigan, ay higit pa sa kayamanan.

6. He is having a conversation with his friend.

7. Ang poot ay isang damdamin na hindi madaling malunasan o mapawi.

8. Hindi ko akalaing may nangahas na gumawa ng ganoong delikadong eksperimento.

9. Nakaupo sa balkonahe, pinagmamasdan niya ang mga tao na dumaraan sa kalsada.

10. Bilang paglilinaw, ang pagsusulit ay hindi bukas kundi sa susunod na linggo.

11. Pumasok sa pintuan ang mga atleta nang limahan bago magsimula ang laro.

12. The weather is holding up, and so far so good.

13. Estoy muy agradecido por tu amistad.

14. The website's loading speed is fast, which improves user experience and reduces bounce rates.

15. Ang sugal ay maaaring magdulot ng pagkawala ng pag-aasenso at pagkakataon sa buhay.

16. Eating a balanced diet can increase energy levels and improve mood.

17. Governments and financial institutions are exploring the use of blockchain and cryptocurrency for various applications.

18. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

19. As a lightweight boxer, he had to maintain a strict diet to stay within his weight class.

20. Ibinigay ng kumpanya ang malaking kawalan sa kanilang kita upang masiguro ang kaligtasan ng kanilang mga empleyado.

21. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

22. Algunas heridas, como las provocadas por mordeduras de animales, pueden requerir de vacunación antirrábica o tratamiento contra el tétanos.

23. Algunas obras de arte son consideradas obras maestras y son muy valoradas.

24. Tengo náuseas. (I feel nauseous.)

25. Kailangan nating magbigay ng halaga sa mga kababawang bagay upang mag-enjoy sa buhay, pero hindi dapat ito maging priority.

26. Maraming bayani ang nagbigay ng kanilang buhay upang makamit ang kalayaan ng bansa.

27. Emphasis can be used to create a sense of drama or suspense.

28. Si daddy ay malakas.

29. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

30. Vi bør fejre og ære vores helte, så de ved, at deres indsats bliver værdsat.

31. Sapagkat batay sa turo ng Katolisismo ay nagpasan ng krus at ipinako sa kabundukan si HesuKristo.

32. Sop buntut adalah sup yang terbuat dari ekor sapi dengan rempah-rempah dan sayuran yang kaya rasa.

33. Tesla vehicles are known for their acceleration and performance, with the Model S being one of the quickest production cars in the world.

34. Isang mahahalagang pag-uusap o tagpo ang naganap sa loob ng kabanata, na nagbibigay ng bagong pag-unawa sa mga karakter.

35. Boboto ako sa darating na halalan.

36. Nagsmile siya, Uuwi ka ha.. uuwi ka sa akin..

37. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

38. Hinahabol ko ang aking hiningang mahina dahil sa kalagitnaan ng marathon.

39. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

40. Namnamin mo ang halik ng malamig na hangin sa umaga.

41. May kinuha sya sa backpack nya, Dapat gumagamit ka nito.

42. Maraming mga tao ang nakatambay pa rin sa mga tindahan sa hatinggabi.

43. The level of sweetness can vary in different types of sugar and sweeteners.

44. She always submits her assignments early because she knows the early bird gets the worm.

45. Kucing di Indonesia juga sering dibawa ke salon kucing untuk melakukan perawatan bulu dan kesehatan mereka.

46. Sa gitna ng pagdidilim, mayroon pa ring mga tala na nakikita sa langit.

47. The professor delivered a series of lectures on the subject of neuroscience.

48. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

49. Kaninang umaga ay bumigay na ng tuluyan ang kanyang katawan, wala ng nagawa ang mga doktor.

50. Eine klare Gewissensentscheidung kann uns helfen, Verantwortung für unsere Handlungen zu übernehmen.

Similar Words

notebookNag-bookfe-facebookfacebookbookse-booksbook:book,

Recent Searches

bookseveralmagulangdiyanbingbingpamilyakalayaanpanindangeleksyonsumimangotnaglulutojoypagkabatactilesmabangosumugodsunud-sunodatinrequirekinakaligligremotepag-iinatraisehjemstedstoreutilizaprogramsipinatawagcosechamahulogtatlongkasoaudiencewalangmaliitphilosopherbetweenkinapanayambuung-buosarilingsinunggabanwonderbagsistemaplaguedakoperooursugatinaibonnuclearmag-asawangmatapobrengmariahigithayopdertienegeneratekaysarapshowstransportationjeepsinapoktinatanongtiniopalibhasalumusobdamittripibinigaymobileleegheartpagkakataongkurbatapagbabagong-anyomerchandisewristmatatagmarahanlaptopgrammarsinopunung-punonapakasinungalingbultu-bultongpinagsasasabimag-ibamakakatulongnaniniwalatrasciendekagatolpersonaspagkainbayabasjodiewasakkanaugalilungkottakipsilimkinukuyomdennebelievedngayomakamitproducirnamulaklakmahagwaygirlfriendtinalikdanmayabanguntimelydugoogorhalagafigurassuzettenitomakatarungangantonioganadividedentoncesexpresanlumuhodtinanongresearch:diyospinagkakaguluhandivisionneropinakamatapatsinungalinggawainglikodkamandagfilmisipomkringtabiimportantpabulongbecamedioxidenagliliyabsitawimageskatagainalagaantanggalinairplaneskadaratingdingdingimporibinibigayearlyituturosocialproduktivitetoffentligagilaelectmaritesmagdugtongindividualsinventedmakesnaglokohantuyotmentalculprittumirasipagmakasilongnewbusilaktrapikbakaorkidyasdiscoveredinternetvigtigstenutrientsspanspagsusulatasotinurokaano-anoprogramapagongbakasyonmalumbaybigkisamazoninteligentespagdidilimumiwas