Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "uno"

1. El dibujo de la anatomía humana fue uno de los mayores intereses de Leonardo da Vinci.

2. El maíz es uno de los principales cultivos agrícolas en muchos países de América Latina.

3. El trigo es uno de los cultivos más importantes a nivel mundial para la producción de harina.

4. La realidad es que las cosas no siempre salen como uno espera.

5. Miguel Ángel es considerado uno de los artistas más influyentes de la historia del arte occidental.

6. Uno de los festivales de música más importantes de España es el Festival de San Sebastián, que se celebra en septiembre y cuenta con la participación de artistas de renombre internacional

7. Uno de mis pasatiempos favoritos es leer novelas de misterio.

Random Sentences

1. Many schools and universities now use television as a way to provide distance learning

2. Many churches hold special services and processions during Holy Week, such as the Stations of the Cross and the Tenebrae service.

3. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

4. Their primary responsibility is to voice the opinions and needs of their constituents.

5. Ipinagbabawal ang paglapastangan sa mga pampublikong lugar tulad ng mga museo at bibliyoteka.

6. Kung anong puno, siya ang bunga.

7. A couple of weeks ago, I went on a trip to Europe.

8. Les jeux de hasard en ligne sont devenus plus populaires ces dernières années et permettent de jouer depuis le confort de son propre domicile.

9. Sa mga tunog ng kundiman, nabibigyang-buhay ang mga kuwentong umiikot sa pag-ibig at pagdurusa.

10. The king's coronation is a ceremonial event that officially marks his ascension to the throne.

11. Ang malakas na tunog ng sirena ay binulabog ang katahimikan ng lungsod.

12. At ignorere sin samvittighed kan føre til følelsesmæssig fjernhed og isolation.

13. Some businesses and merchants accept cryptocurrency as payment.

14. Bakit sila makikikain sa bahay niya?

15. No puedo cambiar el pasado, solo puedo aceptarlo con "que sera, sera."

16. Ang pagsisimula ng malakas na away sa loob ng tahanan ay binulabog ang katahimikan ng pamilya.

17. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

18. A veces es difícil encontrar buenos amigos, pero cuando los encontramos, vale la pena.

19. Ang Ibong Adarna ay patuloy na nakakaakit ng mga mambabasa sa ngayon dahil sa kanyang pagpapakita ng kagandahan ng kultura at panitikan ng Pilipinas.

20. Trump was known for his background in real estate and his role as a television personality on the show "The Apprentice."

21. Johnny Depp is known for his versatile acting skills and memorable roles in movies such as "Pirates of the Caribbean" and "Edward Scissorhands."

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. "Kapag may tiyaga, may nilaga" ay isang bukambibig na nagpapahiwatig ng kahalagahan ng pasensya at pagsisikap upang makamit ang tagumpay.

24. Ang mga kabataan ay kailangan ng edukasyon tungkol sa mga masamang epekto ng pagkakaroon ng sira sa ngipin at hindi pagpapatingin sa dentista.

25. Palibhasa ay madalas na nagsusulong ng mga bagong ideya at mga panukala dahil sa kanyang malawak na pananaw.

26. Nakita ko ang aking guro sa mall kanina kasama ang kanyang pamilya.

27. I am absolutely excited about the future possibilities.

28. Kumain ka na ba? Tara samahan kitang kumain.

29. La habilidad de Leonardo da Vinci para crear una ilusión de profundidad en sus pinturas fue una de sus mayores aportaciones al arte.

30. Kung gusto may paraan, kung ayaw may dahilan.

31. Mabuti na lamang at hindi natuloy ang sumpa.

32. In addition to his musical career, Presley also had a successful acting career

33. May gusto ka bang gawin mamayang gabi?

34. Bahagya na niyang maulinigan ang ina.

35. El internet ha hecho posible la creación de comunidades en línea alrededor de intereses comunes.

36. Bakit di mo 'to sinabi sa akin?

37. Sa dakong huli, na-realize ko na mahalaga ang aking mga kaibigan.

38. Transkønnede personer kan vælge at gennemgå hormonbehandling og/eller kirurgi for at hjælpe med at tilpasse deres krop til deres kønsidentitet.

39. Me gusta preparar infusiones de hierbas para relajarme.

40. Necesito ver a un médico. (I need to see a doctor.)

41. Lasinggero ang tatay ni Gabriel.

42. Nutrient-rich foods are fundamental to maintaining a healthy body.

43. Cancer treatment can have side effects, such as nausea, hair loss, and weakened immune system.

44. She's always gossiping, so take what she says with a grain of salt.

45. Dahil sa pagmamahalan ng dalawang pamilya, ang pamamamanhikan ay naging isang masayang pagtitipon.

46. Naaalala mo pa ba noong tayo pang dalawa.

47. Samantala sa kanyang pag-aaral ng sining, nagpapahayag siya ng kanyang mga damdamin sa pamamagitan ng mga likhang sining.

48. Kapag dapit-hapon, masarap mag-relax sa veranda habang nanonood ng sunset.

49. Les robots dotés d'intelligence artificielle peuvent effectuer des tâches répétitives et dangereuses pour les humains.

50. Sa aming mga tagumpay, nagbabahagi kami ng kaligayahan bilang magkabilang kabiyak.

Similar Words

punosusunodnagkasunognagpakunottumunogKumunotSunud-sunodsumunodPinakamatunogmatipunonasusunogpagkapunosumusunosinunud-ssunodnasunogmarunongnunomasusunodpamumunopunong-punosinunodnakakunot-noongpunung-punopunongkahoypunongmagpapabunotNagsisunodpunong-kahoynakasunodmagsunogsumusunodunos

Recent Searches

asignaturaunosubalittuwidMensahekumbinsihinmalinismulimaramikayingatanmagbigaykatotohananbuhaynagdaankamag-anakgusgusinganongmanggamaligayaBaryongunitkamapatpatsamakatuwidlungsodwatawatvictoriamataasgitarakaniyapamilyakasangkapanbayanlabankasingtigasTradisyonkasivedbarangayedukasyonmariarightsiniyasatseekanaktayopapellaronggalitlegislationvehiclessetsebidensyacrushorkidyassinumanyatakungpagdiriwangmagpahingasalamatna-fundbagkusbayaniaraw-makauwininamalalimpabulongtotoopasaherokayapopulationpagkatakothamonriyannasagutansapagkatpangungutyanasannapakamotsilid-aralankasiyahanpaksaikinagagalakganyanhinditandanggumalamaaringtilahimutokkindskahitbasahinkamalayanlaptopgreenhillsbukasgaanokwartodahillihimkanyangkasalananumupopagtatakapaaralanbaketmestbataykinagalitannenadollaradobosalatpunodaddyperopigingpokertomsystemofrecendawhabanggurodilagyelomaduraslunesmanuksodatugalaankalyetuladsumayawnamatayhunipaskosilaysantopilipinopalipat-lipatairportmag-galabaroburolpasswordinakalaawitkarununganusaeroplanoganidbihasanaghuhukaynagcurvesamantalangpulisemocionescafeterialumipadiwinasiwaskaragatan,matanggapnagbabasatabaslabasmabilistinitindakomunidadcampkasopakanta-kantangrefgawanmarahassinomarahiltumulongicebulongsino-sinoalanganbalitadelcuentakaninhanggangugalikamisetabakaagam-agampanlolokoiligtassumakaypootniyan