Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "amazon"

1. Amazon has a reputation for being innovative and forward-thinking.

2. Amazon has a vast customer base, with millions of customers worldwide.

3. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

4. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

5. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

6. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

7. Amazon is an American multinational technology company.

8. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

9. Amazon started as an online bookstore, but it has since expanded into other areas.

10. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

11. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

12. Amazon's customer service is known for being responsive and helpful.

13. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

14. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

15. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

16. Amazon's Kindle e-reader is a popular device for reading e-books.

17. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

18. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

19. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

20. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

21. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

22. Today, Amazon is one of the world's largest online retailers.

Random Sentences

1. Minsan, ang pag-iisa ay maaaring maging magandang oportunidad para mag-isip at magpahinga.

2. Tweets are limited to 280 characters, promoting concise and direct communication.

3. Dogs are social animals and require attention and interaction from their owners.

4. Human activities, such as pollution and deforestation, have a significant impact on the environment.

5. Palibhasa ay may kakayahang magpakatotoo at magpahayag ng kanyang mga saloobin nang malinaw at mahusay.

6. We admire the courage of our soldiers who serve our country.

7. Ayoko na pong maging pabigat sa kanila.

8. Musk has been named one of the most influential people in the world by TIME magazine.

9. Ang bansa ay hindi lamang sa mga nasa posisyon, kundi sa bawat isa.

10. Saan nangyari ang insidente?

11. At habang itinatapat nito ang balde sa gripo, muli niyang nakita na nginingisihan siya nito.

12. Omelettes are a popular choice for those following a low-carb or high-protein diet.

13. Masarap ang litson kaya lang nakakataba.

14. Unfortunately, Lee's life was cut short when he died in 1973 at the age of 32

15. Ang hindi magmahal sa sariling wika, ay higit pa ang amoy sa mabahong isda.

16. Sa isang forum ng mga mamimili, ibinahagi nila ang kanilang mga mungkahi upang mapabuti ang kalidad ng mga produkto.

17. She has made a lot of progress.

18. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

19. En mi huerto, tengo diversos cultivos de flores y plantas ornamentales.

20. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

21. Los Angeles is home to several professional sports teams, including the Lakers (NBA) and the Dodgers (MLB).

22. Lumapit siya sa akin tapos nag smile. Nag bow ako sa kanya.

23. The sports center offers a variety of activities, from swimming to tennis.

24. Kelahiran bayi adalah momen yang sangat penting dan dianggap sebagai anugerah dari Tuhan di Indonesia.

25. Aaissh! biglang upo si Maico pagka-maktol.

26. Elle adore les films d'horreur.

27. Nalaman ko na ang kanyang halinghing ay dahil sa kanyang asthma.

28. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

29. Goodevening sir, may I take your order now?

30. Matapos ang pangunahing pangyayari sa kabanata, nagkaroon ng bagong direksyon ang kuwento patungo sa susunod na yugto.

31. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

32. Protecting the environment involves preserving natural resources and reducing waste.

33. Natakot umano ang mga estudyante nang marinig ang kwento tungkol sa multo sa eskwelahan.

34. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

35. Malungkot ang lahat ng tao rito.

36. Las hojas de otoño son muy bonitas en la ciudad.

37. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

38. We have visited the museum twice.

39. Las heridas por quemaduras pueden necesitar de tratamientos específicos, como el uso de cremas o apósitos especiales.

40. Naghingi ako ng pahintulot na hiramin ang mga kasangkapan sa kusina para sa aking cooking class.

41. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

42. Les écoles travaillent à fournir un environnement d'apprentissage sûr et inclusif pour tous les étudiants.

43. May kahilingan ka ba?

44. Pada umumnya, keluarga dan kerabat dekat akan berkumpul untuk merayakan kelahiran bayi.

45. Tesla's Autopilot feature offers advanced driver-assistance capabilities, including automated steering, accelerating, and braking.

46. We have completed the project on time.

47. Ang Ibong Adarna ay may mahabang kwento na puno ng kaguluhan at kababalaghan.

48. The festival showcases a variety of performers, from musicians to dancers.

49. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

50. Waring hindi siya sang-ayon sa desisyon ng grupo, ngunit hindi niya ito ipinakita.

Recent Searches

amazonteleponolegislativefionaattorneybalik-tanawnag-iyakankapatidloobnababalotdumilimpuedeburgersinalansannatingpamilyainiisiphampaslupapawisapelyidokasawiang-paladnagbanggaannoelorasinuulcerformasparehastumalikodpopulationmatakawmalalimtanodeksaytedmamanugangingdilimarmednakukulilimasayang-masayangmungkahinagtungolakadmanagermukhanggiftmelissasocietylottomagka-aponaroonkatawanginfinitynasanderpinagsanglaansilyadumiretsoroseelenabagroomlapisgustokalikasanmagsusuotkelantungkodnaghandajuanwagmagkaibiganbernardokasayawasawahuwebespagpapakilalapagkahapoipinatawaganausecnicomaluwangkamianayairportcigarettesupilinpanalanginmangyarirawpaanosamfundnag-aalalanganywherenagpinamumunuansurveysisusuotehehematigasilangkapalmandukotschoolsdaangsilangmangingisdangbilugangnilagangbaclarankalupihukayitinaobkumitamisteryocharitablekongresoumuponoodreamstaga-hiroshimapalusotika-12ideasnaglakadpalabasinuminhinahaplospamamahingalcdmrsinterestssobrapangtomlabingfrescocouldmaubosfaktorer,dagat-dagatangupitneedkulangkatuwaannitokumakainginangcelebrasizeblueequipokapagkahoykumulogiba-ibangmisadahilorasannalalaglagmarasigansuccesswondermagpapakabaitkahitsuzettekakaantaybalatborgeretoolkultursiyamejobakaaksidentepagtataasilogpakilagaywindownagpatimplamakatayosapagkatconsumenagtawananpistanakainomdaddysinasadyadeterminasyonsyncpesossasakyanmarketingmoresegundobibilinaglabadabarongnaglahojanalas-tres