Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "amazon"

1. Amazon has a reputation for being innovative and forward-thinking.

2. Amazon has a vast customer base, with millions of customers worldwide.

3. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

4. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

5. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

6. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

7. Amazon is an American multinational technology company.

8. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

9. Amazon started as an online bookstore, but it has since expanded into other areas.

10. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

11. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

12. Amazon's customer service is known for being responsive and helpful.

13. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

14. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

15. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

16. Amazon's Kindle e-reader is a popular device for reading e-books.

17. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

18. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

19. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

20. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

21. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

22. Today, Amazon is one of the world's largest online retailers.

Random Sentences

1. Oh gosh. Inintay pa sya ng prince, what does it mean?

2. Iron Man wears a suit of armor equipped with advanced technology and weaponry.

3. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

4. He was a master of several different styles, including Wing Chun, boxing, and fencing, and he developed his own style, Jeet Kune Do, which emphasized fluidity and adaptability

5. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

6. Kung ako si Maico? Malamang magwawala ako. aniya.

7. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

8. Ang mga punong-kahoy ay kinikilala rin bilang mga tagapagligtas ng ating planeta dahil sa kanilang kakayahan sa pag-absorb ng carbon dioxide.

9. Hindi lahat ng kaibigan ay laging nandyan.

10. She admires her mentor's leadership skills and work ethic.

11. Fødslen er en tid til at fejre og værdsætte kvinders styrke og mod.

12. Research: Depending on the subject of your book, you may need to conduct research to gather information and support your ideas

13. Mathematical proofs are used to verify the validity of mathematical statements.

14. Hindi ko kayang isipin na hindi kita kilalanin, kaya sana pwede ba kita makilala?

15. Ikinagagalak kong makilala ka, Maria.

16. The pretty lady at the store helped me find the product I was looking for.

17. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

18. Ayokong pumunta sa party, datapwat ayaw kong mabigo ang aking mga kaibigan.

19. Ano ang paborito mong pagkain?

20. Magkapareho ang kulay ng mga bag namin.

21. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

22. Ilang gabi sila titigil sa hotel?

23. Mas mainit ang panahon kung walang hangin.

24. She has learned to play the guitar.

25. Microscopes can also be used to analyze the chemical composition of materials, such as minerals and metals.

26. The dog barks at strangers.

27. Pinikit niya ang mata upang namnamin ang sarap ng tsokolate.

28. Lumingon ang bata sa kanyang paligid, inisa-isa ang mga mukhang nakatunghay sa kanya

29. Paano ka pumupunta sa opisina?

30. Gusto ko na mag swimming!

31.

32. Aku sangat sayang dengan keluarga dan teman-temanku. (I care deeply about my family and friends.)

33. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

34. The Mount Everest in the Himalayas is a majestic wonder and the highest peak in the world.

35. The website has a chatbot feature that allows customers to get immediate assistance.

36. The momentum of the economy slowed down due to a global recession.

37. Palibhasa ay karaniwan nang nakakamit ang kanyang mga layunin dahil sa kanyang determinasyon at tiyaga.

38. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

39. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

40. Børn bør lære om bæredygtighed og miljøbeskyttelse for at bevare vores planet.

41. Hindi na napigilan ni Anna ang kanyang hinagpis nang marinig ang masamang balita.

42. Setiap agama memiliki tempat ibadahnya sendiri di Indonesia, seperti masjid, gereja, kuil, dan pura.

43. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

44. Paano ho pumunta sa Manila Hotel?

45. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

46. Ang kalayaan ay nagbibigay ng inspirasyon at lakas ng loob sa bawat isa upang ipaglaban ang kanilang mga pangarap at layunin.

47. No dejes para mañana lo que puedas hacer hoy. - Don't put off until tomorrow what you can do today.

48. Pito silang magkakapatid.

49. Selain agama-agama yang diakui secara resmi, ada juga praktik-praktik kepercayaan tradisional yang dijalankan oleh masyarakat adat di Indonesia.

50. Los teléfonos móviles también ofrecen una variedad de funciones adicionales, como la capacidad de enviar y recibir mensajes de texto, tomar fotos, acceder a internet y utilizar aplicaciones

Recent Searches

amazonkatagakassingulangkarunungankamatiskakaibangjobsjennyiyoitinindigitinaasipinabalotipakitainyoinstrumentalinomimportanteimbesikinagalitidinidiktaibangkamalayanhumahangoshumahabahukayuminomhugismanipishubadhitsuraperfecthitikhinugothinanaphinanakithimayinhesushanginhandahahanapinhabitgrupograbegoodgayafuryfreefotosforskelligefonosflereeveryendeligellaelevatorelepanteelectionsebidensyaduondoktordiversidaddiscovereddiningdevelopedderde-latadaysdanmarkdamitdaladahonhumigit-kumulangcompanycommercecollectionscashcallercalldinibumangonbulongbuhaybirthdaybinatobinabaratbigkisbigaykalayaanbigasbibilhinbedsbecomebeachbagamatayonaspirationasawaarmaelallowsadvertising,akalaginamotnagbagorichnag-asaranrelonakatitiyakkinumutantag-arawmamayangteacherkubopaboritowikaslavetelevisionpresidentepalagaynasugatansasagotwaymarvinnamumukod-tangilubosulitsumisidmamimilinatingalasusunodsaanmanymasamakolehiyopumuntanapilitangpositibotablespellingsumasambapadremataasthentakbopalagingmalapitngipingpumuslitnangapatdanvideomakapangyarihangnanatilinag-aalangantwo-partynaismalayongpag-uugalivarietypulubiquemorenaonlineyakapnagdiretsokinaumagahannangagsibiliparaisomanggagalingpagka-diwatapaghihirapkungnagc-cravelumayasnakasakaypowerstumatakbotheypintuannaminmahabolreturnedsugatmagpa-picturepasosmaibibigaysumalasalamatpinggankonsentrasyonnalangkatamtamanlaganappumikitphilosophymabaitschoolmatagaltumawakontingsharkpagkatakot