Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

22 sentences found for "amazon"

1. Amazon has a reputation for being innovative and forward-thinking.

2. Amazon has a vast customer base, with millions of customers worldwide.

3. Amazon has been involved in the development of autonomous vehicles and drone delivery technology.

4. Amazon has been praised for its environmental initiatives, such as its commitment to renewable energy.

5. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

6. Amazon has made several high-profile acquisitions over the years, including Whole Foods Market and Twitch.

7. Amazon is an American multinational technology company.

8. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

9. Amazon started as an online bookstore, but it has since expanded into other areas.

10. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

11. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

12. Amazon's customer service is known for being responsive and helpful.

13. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

14. Amazon's headquarters are located in Seattle, Washington, but it has offices and facilities worldwide.

15. Amazon's influence on the retail industry has been significant, and its impact is likely to continue to be felt in the years to come.

16. Amazon's Kindle e-reader is a popular device for reading e-books.

17. Amazon's Prime membership program offers many benefits, including free shipping, access to streaming video and music, and more.

18. Amazon's revenue was over $386 billion in 2020, making it one of the most valuable companies in the world.

19. If you are self-publishing, you will need to choose a platform to sell your book, such as Amazon Kindle Direct Publishing or Barnes & Noble Press

20. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

21. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

22. Today, Amazon is one of the world's largest online retailers.

Random Sentences

1. Supportive care, such as blood transfusions and antibiotics, may be necessary to manage complications of leukemia treatment.

2. Have they made a decision yet?

3. Ngunit naglahong parang bula si Pinang.

4. Pinapairal ko ang aking positibong pananaw sa buhay upang hindi ako magkaroon ng agam-agam.

5. Ang aso ni Lito ay kulay puti.

6. Hindi natin dapat husgahan ang mga tao base sa kanilang kababawan dahil maaaring mayroon silang malalim na dahilan.

7. Michael Jordan is widely regarded as one of the greatest basketball players of all time.

8. Masyadong mahal ang kanyang gustong bilhin, samakatuwid, naghanap siya ng mas murang alternatibo.

9. Necesitamos esperar un poco más antes de cosechar las calabazas del jardín.

10. Women's rights movements have fought for gender equality and greater opportunities for women.

11. Sila ang mga tunay na tagapagtanggol ng kalayaan at karapatan ng mamamayan.

12. Hiramin mo ang aking guitar para mag-practice ng kantang ito.

13. Ilang araw ang reservation natin sa hotel?

14. Durante el invierno, se pueden ver las auroras boreales en algunas partes del mundo.

15. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

16. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

17. Anong petsa na? salubong sa akin ni Aya.

18. El tamaño y el peso del powerbank pueden variar según la capacidad de la batería.

19. At blive kvinde handler også om at lære at tage vare på sig selv både fysisk og mentalt.

20. Sa pamamagitan ng malalim na paghinga at pagsasanay ng pagmameditasyon, ang aking stress ay unti-unti nang napawi.

21. Dapat natin kontrolin ang pagmamalabis sa paggamit ng social media upang hindi ito makaapekto sa ating mental na kalusugan.

22. Hindi dapat natin balewalain ang mga taong nasa paligid natin, datapapwat ay may mga pagkakataon na hindi natin sila napapansin.

23. Lumaganap ang panaghoy ng mga magsasaka dahil sa kakulangan ng tubig para sa kanilang pananim.

24. El uso de drogas puede ser un síntoma de problemas subyacentes como depresión o ansiedad.

25. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

26. Hindi ba nagdaramdam ang nanay at tatay mo?

27. Ano ang kulay ng mga prutas?

28. Sumulat ng tula ang aking guro sa aming klase at pinabasa sa amin.

29. Los padres experimentan una mezcla de emociones durante el nacimiento de su hijo.

30. Kung minsan, akala ng mga tao, masungit siya.

31. L'éducation est un élément clé pour le développement personnel et professionnel.

32. Las redes sociales pueden ser un lugar para encontrar y unirse a comunidades de intereses comunes.

33. Marami siyang ginawang pagkakamali sa proyekto, samakatuwid, hindi ito natapos sa takdang oras.

34. Nakikita si Carlos Yulo bilang inspirasyon ng maraming kabataang Filipino.

35. My sister gave me a thoughtful birthday card.

36. The invention of the telephone and the internet has revolutionized the way people communicate with each other

37. Trump's presidency had a lasting impact on American politics and public discourse, shaping ongoing debates and divisions within the country.

38. Børn skal have mulighed for at udtrykke sig og udvikle deres kreative evner.

39. Nakasuot ng pulang blusa at itim na palda.

40. May kahilingan ka ba?

41. Pinakain ni Rose si Mrs. Marchant ng almusal.

42. May sisenta sentimos nang kumakalansing sa bulsa ng kutod niyang maong.

43. Lingid sa kaalaman ng prinsesa gayundin ang nararamdaman ng bagong kakilala sa kanya.

44. My boyfriend took me out to dinner for my birthday.

45. Nagluto ako ng adobo para sa kanila.

46. Magandang Umaga!

47. Samantalang ang ina naman, si Magda, siyang nag-aasikaso sa kanilang bahay at dalawang anak na sna Maria at Jose

48. Pumapasok siya sa unibersidad araw-araw.

49. The pneumonia vaccine is recommended for those over the age of 65.

50. La realidad es que a veces no podemos controlar lo que sucede.

Recent Searches

amazonnagsasabingpaghahanguanmasayang-masayacuredattentionkaagadduranteadvancementpahinganahulogtumangobilangkinatatalungkuangsighhamonhugismatanggapplatonaibabaclimbedhumaraptipshatinggabikawalanpinag-aralanpassivebeingvariousmag-uusapgamitisinalangkarununganwalisseehiraprestpagongpaparusahantopicmahiwagangnanghihinamadsourcestiniozoonobodylangostapananakitbiglahimutokkuyaanungsusunodgasolinahanangnaturalunti-untistringtinitirhanvelstandperowatchingmanggakinilighayophawakkabiyakpag-isipanbilinapakamotjapanduminilamabilislalapagkakilanlanhimigpinagkaloobansiyamligawanusenatinumiinomnanangisnagpanggapnginingisinagtutulunganhapdiuugod-ugodoraslegislationbuhaykaibiganlalamunankapwanagtitindavidtstraktkikonaglipanaleadlanakabutihanakotaposnakukulilinetflixninyoitinakdangmabangisdaigdigwindowbilugangtumulongcompaniesculturestrabahokastilakasyaiba-ibangfacebookhanapinalasvelfungerendeelectedsingeralongaregladomaliliitparakinainpagkainnagsimulamasasakitgalingmatuklasanmasakitnakataasparknakatagoherundernanditonamantayolihimoperahanpinaghalocalidadnaisipcultivarbalatharap-harapangdumaanagadconnakatawagplasasaankitang-kitabawatyou,pag-uugalishouldnaispositionerlandokumilosmagsasakapagdiriwangsinapakisipanbilibnakipagugalimatatagmakapasakayonaawakaibangnag-replywarimalalapadakalaingkundimaninulitpaggawajoseperpektodanskegymnakumbinsinalalamannalasingeksportererkaibapawiinnagsabayresultahiniritdreamsnaliligo