Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

20 sentences found for "city"

1. A new flyover was built to ease the traffic congestion in the city center.

2. Ang Mabini Bridge ay isang makasaysayang tulay sa Lipa City, Batangas.

3. Batman, a skilled detective and martial artist, fights crime in Gotham City.

4. Ipinanganak si Hidilyn Diaz noong Pebrero 20, 1991, sa Zamboanga City.

5. Los Angeles, California, is the largest city on the West Coast of the United States.

6. Magkano ang pasahe sa bus mula sa Quezon City

7. Nagwo-work siya sa Quezon City.

8. The city has a thriving music scene and is known for its influential contributions to various music genres, such as hip-hop and rock.

9. The city hosts numerous cultural festivals and events, celebrating different traditions and communities throughout the year.

10. The city installed new lights to better manage pedestrian traffic at busy intersections.

11. The city is a melting pot of diverse cultures and ethnicities, creating a vibrant and multicultural atmosphere.

12. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

13. The city's vibrant nightlife offers a variety of entertainment options, including nightclubs, bars, and live music venues.

14. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

15. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

16. The hotel room had an absolutely stunning view of the city skyline.

17. The Watts Towers, a collection of unique and intricate sculptures, are a testament to the city's artistic expression.

18. There are a lot of reasons why I love living in this city.

19. There are so many coffee shops in this city, they're a dime a dozen.

20. They have lived in this city for five years.

Random Sentences

1. Gumagawa ng cake si Bb. Echave.

2. Me encanta pasar tiempo al aire libre durante las vacaciones de primavera.

3. The Twitter Explore tab provides a curated feed of trending topics, moments, and recommended accounts.

4. Tila may lihim siyang itinatago sa atin.

5. Malinis na bansa ang bansang Hapon.

6. If you quit your job in anger, you might burn bridges with your employer and coworkers.

7. Skolegang er en vigtig del af børns opvækst og udvikling.

8. Ang kanyang mga galaw ay tila naglalayo ng loob ng iba, palayo sa kanya.

9. Bitawan mo nga ako, kakainin ko 'to.

10. Napakahaba ng pila para sa mga kumukuha ng ayuda.

11. The restaurant might look unassuming from the outside, but you can't judge a book by its cover - the food is amazing.

12.

13. Kung may tiyaga, may nilaga.

14. Grande married Dalton Gomez, a real estate agent, in May 2021 in a private ceremony.

15. Let's stop ignoring the elephant in the room and have an honest conversation about our problems.

16. To break the ice at a party, I like to start a game or activity that everyone can participate in.

17. Viruses can infect all types of living organisms, including plants, animals, and bacteria.

18. Waring nawawala ang bata dahil hindi niya alam kung saan siya pupunta.

19. At leve med en tung samvittighed kan føre til søvnløshed og andre sundhedsproblemer.

20. Bilang panghabambuhay na parusa ay pinamalagi ng Adang manatili sa labas ng Kasoy ang abuhing Buto nito.

21. Scientific discoveries have revolutionized our understanding of genetics and DNA.

22. Tesla was founded by Elon Musk, JB Straubel, Martin Eberhard, Marc Tarpenning, and Ian Wright.

23. Tumango ako, you want? alok ko sa kanya.

24. A, e, nawawala ho ang aking pitaka, wala sa loob na sagot ni Aling Marta

25. If you think I'm the one who stole your phone, you're barking up the wrong tree.

26. Los trabajadores agrícolas se encargan de cosechar los campos a mano.

27. Ihahatid ako ng van sa airport.

28. Hindi iniinda ng magkakapatid na Lala, Dada at Sasa ang nakapapasong init ng araw sapagkat ito ay nagpapakinis pa nga ng kanilang kutis.

29. This shows how dangerous the habit of smoking cigarettes is

30. Nakiisa naman sa kanilang kagalakan ang mga kapitbahay.

31. Il est tard, je devrais aller me coucher.

32. Ang daming pusa sa bahay nila Jocelyn.

33. Kumain ako sa kapeterya kaninang tanghali.

34. Makapal ang tila buhok sa balat nito.

35. Environmental protection is essential for the health and well-being of the planet and its inhabitants.

36. Viruses are small, infectious agents that can infect cells and cause diseases.

37. Ngunit natatakot silang pumitas dahil hindi nila alam kung maaring kainin ito.

38. Grover Cleveland, the twenty-second and twenty-fourth president of the United States, served from 1885 to 1889 and from 1893 to 1897, and was known for his economic policies and opposition to corruption.

39. Sebagai bagian dari perayaan kelahiran, orang Indonesia sering mengadakan acara syukuran atau kenduri.

40. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

41. Mabait ang pamilya ni Aling Juana kaya panatag ang loob ng ama't ina ni Bereti.

42. Facebook Pages allow businesses, public figures, and organizations to create a public presence and interact with their audience.

43. Hinawakan ko yung kamay niya.

44. Agad na nagliwanag ang kangitan at may sumibol na punong-kahoy sa ibabaw ng nagibang kweba.

45. Ang mga punong kahoy ay nagbibigay ng magandang lilim sa takip-silim.

46. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

47. Smoking is a leading cause of preventable death worldwide.

48. Maingay ang bagong taon sa Pilipinas.

49. Quitting smoking can be challenging and may require support from healthcare professionals, family, and friends.

50. Sa isang iglap ay nakalabas sa madilim na kulungan ang Buto.

Similar Words

publicity

Recent Searches

cityalas-tresbigongskyldesinvitationreviewninyodumiliminfluencespalakafloormapuputimanuelfreelancerso-calledguardakatutuboconectadoschavittools,comienzanseeknangumbidaniyanledexitconsideraraidcallpartneripapainitatafuncionespalayantextoumaagosusingtabamonitorboxcasesstylesmarkedbehalfboyyourshestep-by-steprenombrekaramihanmagka-babyheftyconstantnilulonnailigtasseniortamanghuertomismobio-gas-developingnakitabiyernesdalaanaknowwatchbasahandrogapagka-diwatamakapaibabawbringfridaytumalonpagkataokaraokemapilitangkasangkapantaga-lupangafterkinalakihanmasoknananaghilinakatawagdingdingulong1935verdenmangahasimeldanagitlapamahalaanespanyolnakikini-kinitacoinbasepakpakbuwalrestawantomarlatestzoomnagtuturomakakawawalumalakinagmungkahinalalaglaglaki-lakibinitiwanalagangtog,magbigaytig-bebeintenatuwataoshinahaplospulgadanagwikangitinaasminervieisinalaysayaddingsolidifydoingdependingevolvetoolincreasesmaya-mayanangampanyageologi,ikinamataynakaramdamnamumulaklakngumitipaumanhininferioresnakalipasbuung-buonagpabayadlumiwanagnasasakupannagbibigayseguridadnakakainpahiramsulyapleksiyonkumikilosinvesting:humalopuntahannakatitigasignaturaprodujomaliliitkumakainkare-kareisuotbuntisdeterminasyonnakinigpakisabibilanginsalesinventadosurroundingssumimangotilagaytatlokanilamaramotboholpasigawchoosedikyammagtipidmaibalikisamanagpapaypaypalipat-lipatjokeatentosantolagisyaadangencompassessumuotsalamournedklasrumbalancesgoshdahanbilinatandaansarilingbigthroughoutcommunicationtransit