Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

15 sentences found for "agricultores"

1. La calidad del suelo es un factor clave para el éxito de los agricultores.

2. La falta de acceso a tierras y recursos puede ser un desafío para los agricultores en algunas regiones.

3. La formación y la educación son importantes para mejorar las técnicas de los agricultores.

4. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

5. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

6. La tecnología agrícola ha mejorado la eficiencia y la calidad de la producción de los agricultores.

7. Los agricultores a menudo enfrentan desafíos como sequías, inundaciones y plagas.

8. Los agricultores a menudo trabajan en estrecha colaboración con otros miembros de la cadena alimentaria, como los transportistas y los minoristas.

9. Los agricultores deben estar atentos a las fluctuaciones del mercado y la demanda de sus productos.

10. Los agricultores del pueblo comenzarán a cosechar la siembra de trigo en un par de semanas.

11. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

12. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

13. Los agricultores pueden desempeñar un papel importante en la conservación de la biodiversidad y los ecosistemas locales.

14. Los agricultores trabajan duro para mantener sus cultivos saludables y productivos.

15. Muchos agricultores se han visto afectados por los cambios en el clima y el medio ambiente.

Random Sentences

1. Electric cars are quieter than gasoline-powered cars due to the absence of an internal combustion engine.

2. He won his fourth NBA championship in 2020, leading the Lakers to victory in the NBA Bubble.

3.

4. May mga kuwento sa baryo na ang albularyo ay minsang nagpagaling ng isang taong naparalisa.

5. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

6. Sadyang mahirap ang pag-aaral ng calculus.

7. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

8. They are not shopping at the mall right now.

9. Russell Westbrook is known for his explosive athleticism and ability to record triple-doubles.

10. No puedo comer comida picante, me irrita el estómago.

11. Pakibigay sa driver ang bayad ko sa pamasahe, wala akong abot.

12. Les étudiants sont encouragés à poursuivre des activités de bénévolat pour développer leurs compétences en leadership.

13. He bought a series of books by his favorite author, eagerly reading each one.

14. Naramdaman kong nag vibrate yung phone ko.

15. Gracias por entenderme incluso cuando no puedo explicarlo.

16. Na parang may tumulak.

17. The website's design is sleek and modern, making it visually appealing to users.

18. The widespread use of the telephone has had a profound impact on society

19. Omelettes are a popular choice for those following a low-carb or high-protein diet.

20. Sa probinsya, ang mga bukirin ay sumasalamin sa mayabong na kabuhayan ng mga magsasaka.

21. Have they finished the renovation of the house?

22. Tara Beauty. Mag-gala naman tayo ngayong araw. aniya.

23. Nanood sina Pedro ng sine kahapon.

24. Cheating is a breach of trust and often a violation of the expectations and commitments of a relationship.

25. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

26. Pwede ba ako makahiram ng sapatos?

27. Durante el invierno, algunos lugares experimentan nevadas y paisajes cubiertos de blanco.

28. Weddings are typically celebrated with family and friends.

29. Mababa ang sahod sa trabaho, kaya naghanap siya ng ibang mapagkakakitaan.

30. The restaurant has a variety of options on the menu, from vegetarian to meat dishes.

31. Kanino makikipagsayaw si Marilou?

32. El accidente produjo un gran tráfico en la carretera principal.

33. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

34. Sa paligid ng bundok, naglipana ang mga ibon na nagpapaganda sa tanawin.

35. Ano?! Ibig sabihin.. hinde ako nananaginip nun??

36. Tila bakal na kumakapit ang mga kamay.

37. May luha nang nakapamintana sa kanyang mga mata at ang uhog at laway ay sabay na umaagos sa kanyang liig.

38. Ang puno ng mangga sa bakuran namin ay hitik sa malalaking bunga ngayong tag-init.

39. Sadyang maganda ang panahon ngayon kaya't magpi-picnic kami sa park.

40. Los sueños son el motor que nos impulsa a lograr nuestras metas. (Dreams are the engine that drives us to achieve our goals.)

41. La música es una parte importante de la educación musical y artística.

42. Dahil sa hiya, tuwing gabi na lamang ito mag-isang lumilipad upang humanap ng kanyang makakain.

43. Hindi ko sinasang-ayunan ang kanilang ideya kaya ako ay tumututol.

44. To: Beast Yung friend kong si Mica.

45. His death was a shock to the world, and millions of fans mourned the loss of one of the most important figures in the history of American music

46. They are shopping at the mall.

47. Smoking is prohibited in many public places and workplaces to protect non-smokers from secondhand smoke exposure.

48. Bakit sila makikikain sa bahay niya?

49. Sa likod ng kalsada, nagtatago ang magnanakaw na may dala-dalang sako.

50. Ang pagkuha ng sapat na pahinga at tulog ay isang nakagagamot na paraan upang maibalik ang aking enerhiya at sigla.

Recent Searches

nagkitaagricultoresmakalipaskumakalansingnanghihinanagkalapitmagagawamedisinapambatangskyldes,sanggolpahabolhonestonationaljosiebakantetamarawnasunogpalantandaankapwatuyopakibigayheartbeatkatibayangabigaelsahodmatayogkanayangadmiredhenrybagaynakinigtuvomaisipherramientauntimelyitutolatintraffictodaylabingbroadcastkumarimotforcesbigbumugadedication,artificialbarsteerbetaiginitgitclockpalakolcandidatemagsalitapagkalungkotlamesapinagalitanpagpapautangnagpalalimsunud-sunuranbestfriendpangangatawaneyahelenatindatumikimninanaishigh-definitionmagdaraospananakitjanbankcosechar,governorsgananggoingpresence,self-defenseinangexpresaniigibrenatovistcombinedleadingultimatelylayasnagdaramdamipapaputolgamesexpectationsnilutotabihapasinpossiblesupportpublishedmakaraandiscouragedpamamasyalnasabingexpensesnanamanmangingisdangmahuhulinalakipinapasayalumindolmapakalimakinangpasahetanghalilikodlumamangnabigayestiloslugawshouldpancitpintobumotoisamaosakadogsdahanexhaustedmag-aaralsacrificesubjecttingmininimizejackypingganitinaliheidrewpracticadointeriorroqueviewflashstyrerprovidedibiliwatawatbethvideos,requireskarganghumahangoshikingpagkakayakapnapaplastikanpagtawamagpakasalseguridadibinibigayhandaanlagnatdesisyonannapilisalaminhinilamaibatandangkontrasayawangrowthmatitigasmaaksidentepilanagisingkrusconsumebinulongseebuwantonightsparematindingpostcardkalantheyshowstudents1982makilinginfluenceinternalcontrolledawareattackgeneratedwhilecuandodisyembreselebrasyongratificante,