Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

7 sentences found for "kadalas"

1. Gaano ka kadalas kumain ng baboy?

2. Gaano ka kadalas nag-eehersisyo?

3. Gaano ka kadalas pumunta sa doktor?

4. Gaano ka kadalas uminom ng bitamina?

5. Gaano kadalas kang nag-eehersisyo?

6. Gaano ko kadalas dapat inumin ang gamot?

7. Gaano siya kadalas uminom ng gamot?

Random Sentences

1. Es difícil saber lo que pasará, así que simplemente digo "que sera, sera."

2. Napakamot na lang ng ulo si Kenji.

3. Hinugot ko ang papel sa loob ng envelope.

4. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

5. Mommy. ani Maico habang humihingal pa.

6. Minsan, nagulat ang pamilya sa pagdating ni Roque dahil may kasama itong lalaking may sugat.

7. Omelettes are quick and easy to prepare, making them a convenient meal option.

8. Kevin Durant is a prolific scorer and has won multiple scoring titles.

9. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

10. We admire the courage of our soldiers who serve our country.

11. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

12. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

13. Madali naman siyang natuto.

14. Dala marahil ng konting pagbabago sa kanyang buhok, unti-unting nagbago ang pag-uugali ni Rabona.

15. Palagi sya nagbibigay ng pagkain sa pulubi.

16. Bagkus sa pag-ulan, ang panahon ay mainit at maalinsangan.

17. Adopting a pet from a shelter can provide a loving home for an animal in need.

18. La fotografía es una forma de arte que utiliza la cámara para capturar imágenes y expresar emociones.

19. Give someone the cold shoulder

20. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

21. Los días de fiesta populares durante el invierno incluyen la Navidad y el Año Nuevo.

22. Ang aming angkan ay may malaking bahagi ng kasaysayan ng aming bayan.

23. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

24. Marahil ay nagpaplano ka na ng susunod mong bakasyon kaya't dapat kang mag-ipon.

25. Vous parlez français très bien.

26. La falta de vivienda adecuada y segura es un problema común para las personas pobres.

27. Les dépenses publiques peuvent avoir un impact significatif sur l'économie.

28. Les patients sont souvent mis sous traitement médicamenteux pendant leur hospitalisation.

29. Hindi ko alam kung bakit.. pero naiyak na lang ako.

30. The news might be biased, so take it with a grain of salt and do your own research.

31. Tsss. aniya. Kumunot pa ulit yung noo niya.

32. The team's success and popularity have made the Lakers one of the most valuable sports franchises in the world.

33. Itinago ko ang mga sulat para sa inyo.

34. Ipinaluto ko sa nanay ko ang pansit.

35. Nag re-review si Gina para sa darating na board exam.

36. Mababa ang tubig sa ilog dahil sa tag-init.

37. Kumain na kami ng tanghalian kanina.

38. "Dogs are not our whole life, but they make our lives whole."

39. Andre helte arbejder hver dag for at gøre en forskel på en mere stille måde.

40. The police were searching for the culprit behind the rash of robberies in the area.

41. The patient's prognosis for leukemia depended on various factors, such as their age, overall health, and response to treatment.

42. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. I love to celebrate my birthday with family and friends.

45. Dahil sa matinding ulan, nasira ang aming picnic at ikinakalungkot namin ito.

46. Knowledge is power.

47. Mahalaga sa aming angkan ang pagpapakita ng respeto sa nakatatanda.

48. Ang ilong nya ay matangos naman ngunit bukaka ang mga butas.

49. For doing their workday in and day out the machines need a constant supply of energy without which they would come to a halt

50. People who give unsolicited advice are a dime a dozen.

Recent Searches

maasahankadalasnagwo-workunidosalapaapmagpakaramipinapakinggantumingalaoperativosfulfillmentnaabotmatumalwriting,nagpapaniwalakoreahinilaexigenteunandisensyopanginoonmayrespektivepadalassukatmetodisktirangbinawianginoongendviderehawlade-latamusicalshadesplanning,bibilhinbanlagisuboengkantadamasukoldakilangadvertisingkailannochelangkaymagdaanentertainmentkendisumasaliwcampaignsturonbayangmatunawanubayanindustriyasundalokuwartalimitednoongardenkabuhayannamamatabangyeyvivatayomissionexcitededucationdikyamedsaibinentathanksoundbateryaaksidenteinataketumangoflaviokikoadoboparkinggaglaybrarimalumbaymakasarilingdipangmadurassoccerattractivenunogoshtrenbingocompostdalawstillpaninginaywanseepeepallottedboracaymassespaskokaringdurimatangrosehumanodyanartspagbahingbinigyangvedlinecompartenmalabocoaching:greeniconbilisburdenkinamumuhianrightmovingrolledpinalakingreportleefistsmalimittipgapcasesincreasesbeginningparatingprotestadinaladividesganitoprogrammingattackmemoryautomaticbehaviorcreatebackhatewesternkagipitanagricultoresalbularyopinatidiniinompayopeksmanrhythmnapilingumupoberetininyonaniniwalacandidatemakatatloconcernsnaawagenearbejdsstyrkenapakagandaheartbreaknegosyobinibilangpondoexpresansapilitanghelpedpeoplehinigitnicopriestfrescomalamangninongltonakapagngangalitpagkakatuwaanpagpapakalatikinagagalaknapaiyaknagawangpinapasayamirakatawangbuung-buopapagalitanpagngitikagalakanpinagpatuloynabalitaan