Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "medical"

1. Ailments are a common human experience, and it is important to prioritize health and seek medical attention when necessary.

2. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

3. Ailments can be diagnosed through medical tests and evaluations, such as blood tests or imaging scans.

4. Ailments can be prevented through healthy habits, such as exercise, a balanced diet, and regular medical check-ups.

5. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

6. Ang mga medical technologist nagsisilbi upang magbigay ng tumpak na resulta sa mga laboratory tests.

7. Bukas ay pupunta kami sa isang medical mission.

8. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

9. During hospitalization, patients receive medical care from doctors, nurses, and other healthcare professionals.

10. High blood pressure can be managed effectively with proper medical care and self-care measures.

11. High blood pressure is more common in older adults and those with certain medical conditions.

12. Hospitalization can be expensive, and patients may be responsible for paying for medical bills and other associated costs.

13. Hospitalization can have a significant impact on a patient's overall health and well-being, and may require ongoing medical care and support.

14. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

15. Hospitalization is the process of being admitted to a hospital for medical treatment or observation.

16. Kailangan na nya makuha ang resulta ng medical exam bukas.

17. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

18. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

19. Scientific research has led to the development of life-saving medical treatments and technologies.

20. The charitable organization provides free medical services to remote communities.

21. The development of vaccines and antibiotics has greatly reduced the incidence of infectious diseases, while the use of medical imaging and diagnostic tools has improved the accuracy and speed of diagnoses

Random Sentences

1. Cryptocurrency operates independently of central banks and governments.

2. Sinubukan niyang salatin ang pader sa dilim upang makahanap ng pinto.

3. Ayos lang yun. May nagsabay naman sa akin eh. sabi ko.

4. Ang dalawang isinumpa ay namuhay sa kakahuyan.

5. All these years, I have been surrounded by people who believe in me.

6. Mathematics provides the foundation for other sciences, such as physics and engineering.

7. Emphasis is often used to highlight important information or ideas.

8. Nagbigay ako ng tulong sa mga nangangailangan kaya masayang-masaya ako ngayon.

9. Athena ang aga aga nakasimangot ka na kaagad.

10. Paki-bukas ang bintana kasi mainit.

11. The dedication of parents is evident in the love and care they provide for their children.

12. Ang mga bunga ay nagkaroon ng malaki at maraming tinik na katulad ng rimas.

13. Napatigil ako sa pagtawa ng seryoso nyang sinabi yun, Eh?

14. Lumiwanag ang mukha ni Ana nang makita ang resulta ng exam.

15. Tesla has faced challenges and controversies, including production delays, quality control issues, and controversies surrounding its CEO, Elon Musk.

16.

17. Sa tuwing nagkakasama kami, nadarama ko ang walang hanggang pagmamahal ng aking kabiyak.

18. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

19. Tantangan hidup juga dapat mengajarkan kita tentang nilai-nilai seperti kesabaran, rasa syukur, dan ketekunan.

20.

21. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

22. Eating healthy is an important way to take care of your body and improve your quality of life.

23. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

24. Inakalang madali lang ang gawain, pero ito’y masalimuot pala.

25. May bagong promotion ako sa trabaho kaya masayang-masaya ako ngayon.

26. Ang magnanakaw na kumaripas ng takbo ay nahuli rin sa dulo ng kalsada.

27. Ang pag-ulan sa labas ay animo'y nagpapaligaya sa mga halaman sa hardin.

28. The Great Pyramid of Giza is considered one of the Seven Wonders of the Ancient World.

29. Habang naglalakad sa gabi, nabigla siya sa biglang pagkabagsak ng mga paputok.

30. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

31. Nakuhang muli ang gong at nagkaroon pa ng punong may matamis na bungang hugis kampana ang mga taong-bayan.

32. Nogle helte er berømte idrætsstjerner.

33. Wala na akong natitirang pera, umaasa na lang ako sa ayuda.

34. Good things come to those who wait

35. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

36. The community admires the volunteer efforts of local organizations.

37. Ignorar nuestra conciencia puede hacernos sentir aislados y desconectados de los demás.

38. Napaluhod nalang siya sa harap ng palasyo at umiyak.

39. Coffee contains caffeine, which is a natural stimulant that can help improve alertness and focus.

40. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

41. Joshua, kumusta ang pakiramdam mo?

42. Nasa sala ang telebisyon namin.

43. He has been hiking in the mountains for two days.

44. Bawal mag-drugs dahil ito ay nakakasama sa kalusugan at nakakadulot ng krimen.

45. Sometimes I wish I could unlearn certain things and go back to a time when I was blissfully ignorant of the world's problems - ignorance truly is bliss in some cases.

46. Meron ho ba kayong mainit na kalamansi juice?

47. He does not break traffic rules.

48. Ang abuso sa kapangyarihan ay nagdulot ng katiwalian sa pamahalaan.

49. Tanggalin mo na nga yang clip mo!

50. Women have been leaders in social justice movements, such as the civil rights movement and the women's suffrage movement.

Recent Searches

lalakadlumuwasmedicalmangingibigmedikalpalancaantoknaliwanaganhayaanpinakidalaibiniliracialsocialepambahaytugonpagkatpagtinginmatipunodumilimtenersellingmaongsakimpelikulanatulaktransportationawardpersonaminkinatatalungkuangnakaupokakuwentuhanmagsasalitapagluluksamagsalitanamumukod-tangikayang-kayangpinagkaloobantumayosalamangkeromagkakailamusicianmakikipagbabagnapaluhanakagawianmanamis-namispare-parehonanlilimahidkagandahagnagpapaigibnakakatulongnagagandahanmoviesmaytinanongpinakamahabapagkapasokinferiorespaglalabadanakakagalapamilyangnagkwentonamumulottumahimikpinabayaanlumiwagtatawaghubad-baropamahalaankalayaansabadonglumagokisapmatagawainbangkangkampanakuripotmaghaponnakapagproposeenglishpinangalananmaghihintaynagsineinuulampatakbokapintasangharapanumigtadpananakitjulietfavorbuhawikalaronobodysakyanasukalkalabandepartmentbintanacaracterizamanakbonaantigkuligligtsonggocombatirlas,feedbackpagtawakuwadernounattendedkahariankubyertosnakatagopaumanhinkare-karemagpapagupitnapipilitankalaunanbiologinagtataasgagawinkumaliwanaglakadpositibodakilanghinukaymasukolpneumoniamagtanimumulanrequierennanigasbutterflytmicalaganapginoongnatalomaaksidentemakabalikniyoeksportennahulogbutoomfattendeopportunitypulongnagdaosbesesmaatimmauntogsinisimagdilimmatalimkaniyakapalbantulotbunutangamitincineparisolarcomputere,krustumangoailmentswereklasrumattractivesinumangbinasadinanaspresyobestdyipyunklasengproudnogensindesalatskyldeskasakitanalayawmalikotinangbigongahasnagisingkuwebaculpritnoongapoymangenatandaanpakilutolikesdisyembrenuhparkesonidoland