Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "siglo"

1. Durante el siglo XX, se desarrollaron diferentes corrientes musicales en España, como el Nuevo Cine Español y el flamenco

2. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

3. En el siglo XVII, el Barroco español produjo figuras importantes como Francisco Guerrero y Tomás Luis de Victoria

Random Sentences

1. She has been exercising every day for a month.

2. Maraming bagay ang kailangan isaalang-alang sa pagpaplano ng kasal, tulad ng budget at mga bisita.

3. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

4. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

5. Limitations can be physical disabilities, such as hearing or vision loss, or mental health conditions, such as anxiety or depression.

6. In 2017, ariana grande organized the One Love Manchester benefit concert following the tragic Manchester Arena bombing at her concert.

7. Bago ang kasal, nagkaruon muna sila ng seremonya kung saan nagmamano siya bilang bahagi ng pamamamanhikan.

8. Ang sugal ay isang laro ng pagkakataon na kadalasang nagbubunga ng pagkatalo kaysa panalo.

9. Hawak niya yung kamay ni Gelai habang palapit sa amin.

10. Ketika dihadapkan pada tantangan, penting untuk memiliki sikap positif dan optimis.

11. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

12. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

13. Mababa ang tubig sa ilog dahil sa tag-init.

14. Electric cars have a lower center of gravity, which can improve handling and stability.

15. Nagsalita ako upang iparating ang aking pagtutol sa kanilang plano ngunit hindi nila ito pinakinggan.

16. It is one of the most important inventions in human history, as it has revolutionized the way we communicate and has played a crucial role in shaping modern society

17. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

18. At følge sine drømme kan føre til stor tilfredsstillelse og opfyldelse.

19. The hotel room had an absolutely stunning view of the city skyline.

20. Kailangan kong hiramin ang iyong pliers para sa aking proyektong DIY.

21. Parang kaming nageespadahan dito gamit ang walis at dustpan.

22. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

23. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

24. Kings have held power throughout human history, from ancient civilizations to modern times.

25. They do not skip their breakfast.

26. Les habitudes de vie saines peuvent aider à prévenir les maladies et à maintenir une bonne santé tout au long de la vie.

27. He is widely considered to be one of the most important figures in the history of rock and roll and has had a lasting impact on American culture

28. Ang tagumpay ng aking proyekto ay nagpawi ng aking mga pag-aalinlangan at pagdududa sa aking kakayahan.

29. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

30. Limitations are a part of life, and how one approaches and overcomes them can shape their character and experiences.

31. Would you like a slice of cake?

32. We need to get this done quickly, but not by cutting corners.

33. Mahalaga ang papel ng mga organisasyon ng anak-pawis sa pagtitiyak ng kanilang mga karapatan.

34. Palibhasa ay mahusay sa pagbasa ng mga komplikadong mga aklat at materyales.

35. Nagtitinda ang tindera ng prutas.

36. If you think she'll forgive you, you're barking up the wrong tree.

37. Endelig er Danmark også kendt for sin høje grad af økologisk bæredygtighed

38. The teacher assigned a hefty amount of homework over the weekend.

39.

40. Kailangan kong lumakas ang aking loob upang maalis ang aking mga agam-agam sa aking mga pangarap.

41. Sa dakong huli, naramdaman ko na wala na akong lakas.

42. Hindi umimik si Lory sa mga tanong ni Chad.

43. Natutuhan ng mga mag-aaral ang talambuhay ni Lapu-Lapu bilang isang bayaning lumaban sa dayuhang mananakop.

44. Ang Ibong Adarna ay kinikilala bilang isa sa mga pinakamahalagang kwento sa panitikang Filipino.

45. We have a lot of work to do before the deadline.

46. The chest x-ray showed signs of pneumonia in the left lung.

47. Naku, wala ka naming gagawin sa Davao.

48. Nationalism is often associated with symbols such as flags, anthems, and monuments.

49. Las heridas profundas o que no dejan de sangrar deben ser evaluadas por un profesional médico.

50. Ang sugal ay isang mapanlinlang na industriya na nakatuon sa pagkuha ng pera mula sa mga manlalaro.

Recent Searches

tutungosigloactivityasopagkaawamaispag-irrigatewaysnuevosutak-biyaatensyongisinuotamericantime,mundonakangitingpakinabangantuvotekamobilitypromotecedulamakapalexhaustionyourself,kampeonforskel,topicdumalawmagtiwalainastanaalalaginagawaasinkayongnamumuoulamtrentatenidonanggagamotmahirapkatabingboyetsumalaalmacenarkaklasematabanagpagupitmaskcomeitemsbarung-barongtumakasarbejdermasasalubongmallpakakatandaanromanticismoestatepinagtagpoclockkomunikasyonsamantalangmarangyangmaalwangsaritaisaacpepefavorbinilinakayukospendingmarsonagbantaybroadnapakomaglalakadikinatatakoteksportererkalasasapakinmakakabaliksolidifylinggointerpretinginterviewingprocesograduallykarwahengpresidentialkaloobanginuunahannoonhawakanincludeinterests,totoongnapakamisteryosoheartbeatmaghihintayindustriyagumigisingafternoonpinagsasasabimagtatampocongratsbiocombustiblestatawagkalaropaglipasmakaraan1954twitchsetscallminatamissunud-sunod18thpaki-chargenasaancorrientesmemoanywherelabing-siyammakahiramtumalabpagsahodmayamayamicakailanninongcoughingcnicowaterpalakapagtungonasabitinahaksuelokainitanpinagmamasdangratificante,nearleadingkommunikerer300joyfiancetanimuwaktog,ebidensyasilbingkoreatienemabangonagtagponaawanakaakyatnaniniwalapinanawannakakatandaadmiredmagbasapadabogshortdagattransmitidasdonediniumiinomnapapahintonagsilapitmagnakawpaskonilaosevolucionadoanaktherepumasokdyipniiikotpasyainformationnababalotednaaccessstartedindividualpakipuntahanhotelprovidelumapitkindergartenmatalinomandukototsoeksamanimnagbago