Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "produce"

1. Ang mga puno at halaman ay nag po-produce ng oxygen.

2. El agricultor cultiva la tierra y produce alimentos para el consumo humano.

3. Electric cars are environmentally friendly as they emit no tailpipe pollutants and produce zero greenhouse gas emissions.

4. La tos convulsiva es una tos prolongada y violenta que se produce en ciclos.

5. La tos productiva es una tos que produce esputo o flema.

6. La tos seca es una tos que no produce esputo o flema.

7. Lazada has launched a grocery delivery service called LazMart, which delivers fresh produce and household items to customers.

8. The grocery store offers a variety of fresh produce, including fruits and vegetables.

9. While the advanced countries in America and Europe have the wealth and scientific know-how to produce solar and nuclear energy on a commercial scale, the poorer Asiatic countries like India, Pakistan, and Bangladesh may develop an energy source by bio-gas-developing machines

Random Sentences

1. The executive branch, represented by the President of the United States, is responsible for enforcing laws

2. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

3. Isang makisig na binata na halos kaedad din ng magandang prinsesa.

4. Magkano ang isang kilong bigas?

5. Nanggaling ako sa loob ng sinehan at napakadilim ng paligid dahil sa matinding liwanag sa loob.

6. Ang kaaway sa loob ng bahay, ay higit na nakakasakit kaysa kaaway sa labas.

7. Wala ka naman palang pupuntahan eh, tara na lang umuwi na!

8. Mange mennesker deltager i påsketjenester i kirkerne i løbet af Holy Week.

9. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

10. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

11. Iparating mo ang mensahe sa mahal na hari.

12. Sadyang masarap ang lutong ng tinapay na ito.

13. Nanahimik na nga lang din ako kasi nakakapagod makipagtalo.

14. La moda de usar ropa estrafalaria está llamando la atención de los jóvenes.

15. Børn bør lære om ansvar og respekt for andre mennesker.

16. Leonardo da Vinci trabajó para los Médici en Florencia.

17. Hitik na hitik sa bunga ang nasabing puno.

18. Nag hiking kami sa Mt. Makiling.

19. Con paciencia y dedicación, se puede disfrutar de una deliciosa cosecha de maíz fresco

20. Ang paglapastangan sa kalayaan ng pamamahayag at malayang pagpapahayag ay isang pagkitil sa ating demokratikong prinsipyo.

21. Tinignan ko siya sa nagtatanong na mata.

22. La calidad del suelo es un factor clave para el éxito de los agricultores.

23. Napaluha si Aling Pising nang makita niya ang bunga nito.

24. Dahil sa magandang kwento, hindi ko namalayang nahuhumaling na pala ako sa pagbabasa ng nobela.

25. He plays chess with his friends.

26. He was advised to avoid contact with people who had pneumonia to reduce his risk of infection.

27. Nationalism has played a significant role in many historical events, including the two World Wars.

28. The weather was bad, and therefore the game was cancelled.

29. Tak ada gading yang tak retak.

30. Nagtayo ng scholarship fund si Carlos Yulo para sa mga batang gustong mag-aral ng gymnastics.

31. Kevin Garnett was a versatile power forward who brought intensity and defensive prowess to the court.

32. La labradora de mi amigo es muy valiente y no le teme a nada.

33. Pagkatapos maligo, ang katawan ay nagiging mabango at malinis sa amoy.

34. She does not gossip about others.

35. Anak, iwasan mo si Don Segundo, baka ikaw ay mapahamak, pagpapaalaala ng nangangambang ina.

36. This allows students to take classes from anywhere, and it also allows for the creation of specialized programs and courses that would not be possible in a traditional classroom setting

37. Natawa nanaman sya, Hindi, maganda sya.

38. Einstein was an accomplished violinist and often played music with friends and colleagues.

39. The team is working together smoothly, and so far so good.

40. Bigla, ubos-lakas at nag-uumiri siyang umigtad.

41. Bumagsak ang nawalan ng panimbang na si Ogor.

42. All these years, I have been learning to appreciate the present moment and not take life for granted.

43. The Victoria Falls in Africa are one of the most spectacular wonders of waterfalls.

44. Walang sinumang nakakaalam, sagot ng matanda.

45. Para lang ihanda yung sarili ko.

46. The power of a single act of kindness can be immeasurable in its impact.

47. Emphasis is often used in advertising and marketing to draw attention to products or services.

48. Los héroes son reconocidos y celebrados por su valentía y altruismo.

49. May mga taong may agam-agam sa mga pangarap nila sa buhay kung ito ba ay magkakatotoo o hindi.

50. I woke up to a text message with birthday wishes from my best friend.

Similar Words

producerer

Recent Searches

diferentesproducenangingilidandreamaibigaytiemposgalaanpaanoisabinabaanlackplayedgumuglongbairdlingidguhitupopancitabenekwebangwideearnsumusunosahodkasinggandacoloursincejamesgamewriting,whilesagotuloquicklybitbitmobilecontinueslandesinipangpagsalakaymanamis-namiskasakitumakyatmamalasinuulamseekincitamenterpagsubokpaglakinamulatyumaocharmingbranchesnakakagalapinaghatidanhinimas-himastanimkuligligsandwichhastambayansarabeingipongbumabafaultperasumaliwalletnalasingdaandedication,dogangkingfrogtablestoplighttechnologiesanimevilventasofaboxtumahimikaanhinpinahalatanauponagpaiyaknagtrabahomarketplacesextrapaligsahanpagguhitnaliligonasaanhinihintaythanksgivingnapasubsobmabaitmariaindividualskumbentosuwailcarollalakesocialebibilhinmakulityeshydelhumanosmaskmallfeedback,artswestdettedinanaspriestprutasmalihisnahihilowasteincidencekatapatmatapangquezonmakakakaintirangriegakuwartonangingisaylandassurveystindahanpakistanbayadpinansinnaabutanpagpilisalitapronounnagpagupitnapaiyakpodcasts,ginugunitanakapagreklamogayunpamannagpapaniwalapinagsikapannasasalinanmagtigiltinakasanmedicinenapasigawtatagalcancerdulongpuntarobinhoodtawananpagpasokplanning,shadesgloriasinisigrocerykatagangpatienceestatekenjingisi1960sgaanoeksportennilapitanlordhangaringleoanimoyreadersremainpierbatokpaskogongdulotsuccessgrinscineonlineasoiiklihayasthmabinabanerissaplannaggingtoo