Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "innovation"

1. Ailments can be a source of inspiration for medical research and innovation to develop new treatments and cures.

2. Cancer research and innovation have led to advances in treatment and early detection.

3. Dette skyldes, at den offentlige regulering sikrer, at der er en vis grad af social retfærdighed i økonomien, mens den frie markedsøkonomi sikrer, at der er incitamenter til at skabe vækst og innovation

4. Drømme kan være en kilde til kreativitet og innovation.

5. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

6. Limitations can be challenging, but they can also inspire creativity and innovation.

7. Musk's companies have been recognized for their innovation and sustainability efforts.

8. The United States is a leader in technology and innovation, with Silicon Valley being a hub for tech companies.

9. Women have been instrumental in driving economic growth and development through entrepreneurship and innovation.

Random Sentences

1. Nag silbing inspirasyon si Andres Bonifacio laban sa mga inaapi.

2. La adicción a las drogas puede afectar negativamente las relaciones familiares y de amistad.

3. El papel del agricultor en la sociedad es crucial para garantizar la seguridad alimentaria.

4. Malapit na naman ang bagong taon.

5. Basketball can be a fun and engaging sport for players of all ages and skill levels, providing an excellent opportunity to develop physical fitness and social skills.

6. Shaquille O'Neal was a dominant center known for his size and strength.

7. El mal comportamiento en clase está llamando la atención del profesor.

8.

9. Sa tapat ng posporo ay may nakita silang halaman na may kakaibang dahon.

10. Mommy. ani Maico habang humihingal pa.

11. ¡Buenas noches!

12. Han blev forelsket ved første øjekast. (He fell in love at first sight.)

13. Hindi mo gusto ang lasa ng gulay? Kung gayon, subukan mong lutuin ito sa ibang paraan.

14. Disse inkluderer terapi, rådgivning og støttegrupper.

15.

16. Mi sueño es convertirme en un músico famoso. (My dream is to become a famous musician.)

17. The Angkor Wat temple complex in Cambodia is a magnificent wonder of ancient Khmer architecture.

18. Les patients peuvent avoir besoin de soins palliatifs pendant leur hospitalisation.

19. Tesla has made significant contributions to the advancement of electric vehicle technology and has played a major role in popularizing electric cars.

20. I have been learning to play the piano for six months.

21. Bawal magtapon ng basura sa hindi tamang lugar dahil ito ay maaaring magdulot ng sakit at katiwalian.

22. Naririnig ko ang malakas na tunog ng ulan habang ako ay tulala sa bintana.

23. Det er vigtigt at give børn en kærlig og støttende opvækst.

24. May mga nagpapaputok pa rin ng mga paputok sa hatinggabi kahit bawal na ito.

25. Tumayo na sya, Ok! I'll be going now, see you tomorrow!

26. L'intelligence artificielle peut être utilisée pour détecter les fraudes financières et les menaces à la sécurité.

27. Kukuha lang ako ng first aid kit para jan sa sugat mo.

28. May sinasabi ka ba? umiling ako sa tanong ni Kenji

29. Les comportements à risque tels que la consommation

30. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

31. Twitter chats are organized conversations on specific topics, usually held at designated times using a specific hashtag.

32. Jeg har aldrig mødt en så fascinerende dame før. (I have never met such a fascinating lady before.)

33. Ang edukasyon lamang ang maipapamana ko sayo.

34. Sabay sabay na nagtanghalian ang mga estudyante sa canteen.

35. Nanalo siya ng sampung libong piso.

36. I am absolutely thrilled about my upcoming vacation.

37. Nasa kumbento si Father Oscar.

38. Magaganda ang resort sa pansol.

39. He's known to exaggerate, so take what he says with a grain of salt.

40. He is also remembered for his generosity and philanthropy, as he was known for his charitable donations and support of various causes

41. His music continues to be popular, and his influence can be seen in the work of countless musicians and artists

42. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

43. Some individuals may choose to address their baby fever by actively trying to conceive, while others may explore alternative paths to parenthood, such as adoption or fostering.

44. Umiling siya at umakbay sa akin.

45. Sa bawat salita ng kundiman, nararamdaman ang pait ng paghihintay at pangungulila.

46. Magtatampo na ako niyan. seryosong sabi niya.

47. He has bigger fish to fry

48. Les écoles offrent des bourses pour aider les étudiants à payer leurs frais de scolarité.

49. Sa pamamagitan ng kundiman, naipapahayag ang mga hindi nasasabi ngunit nararamdaman ng mga pusong sugatan.

50. Wala pa ba? seryoso niyang tanong.

Recent Searches

innovationkaniyapakainingrewmatalimvelfungerendebagyolabahingreatdalawinumanorailwaysfuelawamenosseriouspopularizemaestroiguhitdulotsalabuslonasabingpasensyapssscapacidadnasanlilymatigasahasantokdomingoabalatelangkargangdettesiyawestpolosweetlordmagdalayasbrindaranimoycupidfiaiskonegroswebsitekitngpuntayoungworryfanspaadeledaangtrippalaginglinepasangbinabaanuponcornerstoplightblesshimigsecarsejunioinilingspeechtrainingwaysredlasingpartmanagervasquesfinishedmitigateincreasepupuntamakingtermlearnskillinvolvefacultyrepresentedhapasinjohnuddannelsetumakasprogrammingprogresscomplexdoesulingshiftinitmathulotopicpublishedcertainofteniginitgitpacemulingsuelopinatidmagpakaramipanibagongnahigitanhowevernakasahodpaglingonelvismaliwanagellatumitigilnagbantaypinigilannapilitangnagpagawasaktangreennakabawiipinauutangnakapangasawaduligusting-gustomahuhulithankshiramuniquecontestupoalituntuninnababakaskulungantaostalenttuktokcanteentumatawadcoughingmahalagaallebuntisninongmagawakasalukuyangpakilutoadangnagpanggapdamasohetokaibalightstransiteranmasasayahoneymoonmahiyakinabubuhaynami-missartistnaglahokalakikongresopagkaraahulumagalangpatakbomagsasakapamasahetumiratagaytaypaghahabipagkuwankumakainsundalokinalilibinganengkantadangnaiisipmagdamagannakahugkuryentepagkagalitsabihinngumingisikaklaseabut-abotnangyarimakauwimakawalaintensidadmamalas