Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "3hrs"

1. Samahan mo ako sa mall for 3hrs!

Random Sentences

1. Le marché boursier peut être un moyen de faire fructifier son argent.

2. Today is my birthday!

3. She is not drawing a picture at this moment.

4. Nakakain ka ba ng mga pagkaing Pilipino?

5. In addition to his NBA success, LeBron James has represented the United States in international basketball competitions, winning two Olympic gold medals in 2008 and 2012.

6. Dahil sa pagiging maramot, madalang siyang bisitahin ng kanyang mga kaibigan.

7. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

8. Hindi maganda ang magkaroon ng maraming utang dahil ito ay nagdudulot ng dagdag na gastos at kahirapan sa buhay.

9. Pagkatapos ng misa, nagbigay ang pari ng mga panalangin para sa mga kaluluwa sa purgatoryo.

10.

11. Nasaan ba ang pangulo?

12. Ang suporta ng pamilya ni Carlos Yulo ang naging pundasyon ng kanyang tagumpay.

13. Titira kami sa Banawe sa darating na panahon.

14. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

15. Sa panghihiyang ginawa ni Kablan, gumanti ang pobreng matanda.

16. La calidad y la frescura de los productos agrícolas dependen en gran medida de la habilidad y la dedicación del agricultor.

17. Transportmidler er også et område, hvor teknologi har gjort en stor forskel

18. Les parents sont encouragés à participer activement à l'éducation de leurs enfants.

19. Les étudiants peuvent obtenir des diplômes dans une variété de domaines d'études.

20. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

21. He had a bad day at work, and then he got a parking ticket. That just added insult to injury.

22. Napatayo si Magda sa bangka, dahil alam niyang hindi marunong lumangoy ang dalawang bata.

23. Nagulat ang magkasintahan nang biglang dumating ang pamilya ng lalaki para sa pamamamanhikan.

24. Sa bundok ng mga anito na ngayon ay kilala bilang bundok ng Caraballo itinindig ang krus.

25. Sadyang kaunti lamang ang alam kong mga lenggwahe.

26. Madalas na naglulusak sa dumi ang mga bakuran.

27. Paano ho ako pupunta sa palengke?

28. AI algorithms can be trained using large datasets to improve their accuracy and effectiveness.

29. My coworker was trying to keep their new job a secret, but someone else let the cat out of the bag and the news spread like wildfire.

30. Saan-saan kayo lumibot sa Amerika?

31. The festival showcases a variety of performers, from musicians to dancers.

32. Sa ganang iyo, mas epektibo ba ang online classes kaysa sa face-to-face na pagtuturo?

33. He has been named NBA Finals MVP four times and has won four regular-season MVP awards.

34. Sa hatinggabi, maraming establisimyento ang nagsasarado na.

35. El invierno es la estación más fría del año.

36. Nagpa-photocopy ng lumang diyaryo

37. She prepares breakfast for the family.

38. Waring hindi pa handa ang kanyang puso na magmahal muli.

39. Emphasis can help to ensure that a message is received and understood by the intended audience.

40. Panahon na lang ang hahatol kung nararapat na ngang ibalik sa dating anyo si Kiko.

41. Hindi ako sang-ayon sa mga pangyayari sa paligid natin ngayon.

42. De har gjort det muligt for os at automatisere mange af vores daglige opgaver og øge vores produktivitet

43. Es importante ser honestos con nosotros mismos para tener una buena conciencia.

44. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

45. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

46. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

47. Si Tony ay nakapagtapos sa elementary at nagging balediktoryan

48. Ramdam na ang pagod at hingal sa kaniyang pagsasalita.

49. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

50. You can find freelance writers who are willing to work for cheap rates, but good ones are not a dime a dozen.

Recent Searches

tataas3hrsmananaigniyamagtipidkaharianituturosalitangindividualssocialeinfluencesmaliitamendmentsbiyassantosanywhereairconhumahabalipadnetflixtamabalatinvitationpangilandresdiyosangtinikmantillreachnakaka-inaabotmangingisdastomapahamaksumuotbumotobiliprimerosiniwan1940business,legislationcalciumkwebaibonsumayaneaespanyolbilhintingcardcollectionsscientificsweetconsistkablanlegenddidingipinastatusnilutobelievedguardaproveipagamottumutuboistasyondibisyonreleaseddiyosatiyotinuturosourcenanatilikaniyaferrermanatilimahalagaofrecenmangungudngodkuryentekusineroiyorenombreyumabongtanganprogramaworkshopbitbitanotherstatingboylimititinuringgalitsakaylibrotechnologiesnakuhafacilitatingknowswouldkabilanglalakengannaideyamethodslearningakmangconventionalnamatayamongnagtatakboreferspondonagmamaktolbuwalwatersumisidflereharidikyambaulsparkwealthdolyarkubyertosinuminrepresentativesgrabemanggagalingjackyngayontradekasingthroatbyggetanilahisanumangumiinomestablishedhanapbuhayrepresentativekirbywantberegningerdissekainisasthmaadvancesexamplelazadalayawnararapatcarriesenfermedades,playssinabigrupowakasyeplarongilagayfeedback,paanotatloremotetodaypinagawanananalonghagdanankulungannakikihukaypaki-drawingdispositivonaguguluhandagat-dagatancoincidenceunconventionalenvironmenttinulak-tulakpaglapastanganpinaghandaanmulti-billiondiscipliner,mahiwagawikaculturesisinamabeyondlendhopetayongfollowedmansanasbirotilimeetanak-mahirap