Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "incredible"

1. He is also remembered for his incredible martial arts skills, his charismatic stage presence, and his dedication to personal development

2. Kobe Bryant was known for his incredible scoring ability and fierce competitiveness.

3. LeBron James is known for his incredible basketball IQ, versatility, and ability to dominate the game in various positions.

4. Lee's martial arts skills were legendary, and he was known for his incredible speed, power, and agility

5. Olympic athletes demonstrate incredible dedication through years of rigorous training and sacrifice.

6. Superman possesses incredible strength and the ability to fly.

7. The Amazon Rainforest is a natural wonder, home to an incredible variety of plant and animal species.

8. The Incredible Hulk is a scientist who transforms into a raging green monster when he gets angry.

9. The singer on stage was a beautiful lady with an incredible voice.

Random Sentences

1. Subalit pinipilit pa rin niyang maging malakas bagamat talagang di na kaya ng kaniyang pang tumayo ng kahit ilang sandali man lang.

2. Paki-drawing mo naman ako ng isang magandang larawan.

3. The company's profits took a hefty hit after the economic downturn.

4. The United States is a popular destination for tourists, with attractions such as national parks, theme parks, and museums.

5. Einstein was offered the presidency of Israel in 1952, but declined the offer.

6. The United States has a system of separation of powers, where the legislative, executive, and judicial branches operate independently of one another

7. En el siglo XIX, el Romanticismo español tuvo un gran impacto en la música, con compositores como Isaac Albéniz y Manuel de Falla

8. Malapit ang eskuwela ko sa bahay namin.

9. Ang panaghoy ng bayan ay naging inspirasyon upang magkaisa para sa pagbabago.

10. Natuto siyang lumaban sa kaniyang mga magulang.

11. Hindi ko inakalang siya ang nangahas na maglagay ng graffiti sa pader ng paaralan.

12. Naglalaway ako sa amoy ng niluluto mong adobo.

13. Cada nacimiento trae consigo la promesa de un futuro lleno de posibilidades.

14. Tumahol ang aso at natakot ang pusa.

15. Ang aking teacher ay hindi muna nagturo ngayong araw.

16. Nagpakilala ang binata bilang isang prinsipe ng isang malayo at kaibang kaharian.

17. Nagkamali ako ng bitbitin, wala akong kubyertos para sa packed lunch ko.

18. No puedo comer comida picante, me irrita el estómago.

19. Sa simoy ng hangin, maaamoy ang mabangong amoy ng damo sa bukid.

20. They engage in debates and discussions to advocate for their constituents' interests and advance their agendas.

21. Players move the puck by skating, passing, or shooting it towards the opposing team's net.

22. Nanood sina Pedro ng sine kahapon.

23. Natawa ako sa maraming eksena ng dula.

24. The film director produced a series of short films, experimenting with different styles and genres.

25. Kinakabahan ako para sa board exam.

26. The objective of football is to score goals by kicking the ball into the opposing team's net.

27. My best friend and I share the same birthday.

28. Gumawa si Tatay ng makukulay na saranggola para sa piyesta.

29. Scissors are an essential tool in classrooms for art projects and cutting paper.

30. Sa hirap ng buhay, ang aking kabiyak ay ang aking kakampi at kasama sa pagtahak ng mga hamon.

31. Ano ang isinulat ninyo sa card?

32. La realidad es que nunca sabemos lo que nos depara el futuro.

33. Omelettes are a popular choice for those following a low-carb or high-protein diet.

34. Sa ganang iyo, dapat bang palakasin pa ang kampanya laban sa fake news?

35. Comer saludable es una forma importante de cuidar tu cuerpo y mejorar tu calidad de vida.

36. Makikitulog ka ulit? tanong ko.

37. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

38. Ako si Rodona ang diwata ng budok na ito.

39. Upang makatiyak, isinama ng datu ang pinakamatapat na kawal nang dumating ang ikatlong gabi.

40. Naku wala yun, pagngiti ko dun sa babae.

41. Pupunta ako sa Germany sa susunod na taon.

42. The website's design is sleek and modern, making it visually appealing to users.

43. Les travailleurs doivent respecter les heures de travail et les échéances.

44. Kumain ka ng gulay upang maging malusog ka.

45. Ang dedikasyon ni Carlos Yulo sa kanyang isport ay nagdala sa kanya ng tagumpay sa pandaigdigang entablado.

46. All these years, I have been working to make a positive impact on the world.

47. Limitations can be viewed as opportunities for growth and personal development.

48. Nagpaluto ang nanay ko ng adobo sa akin.

49. The treatment for leukemia typically involves chemotherapy and sometimes radiation therapy or stem cell transplant.

50. Mahina ang signal sa kanilang lugar, samakatuwid, nahirapan siyang makipag-usap sa telepono.

Recent Searches

ipinansasahoggroceryincrediblenagwikangniyoinintayumibigabutanngipingkamotemariebinatilyobantulothinampasminahanpelikulapamamahingapaldanaispusagymmusiciansgagambaaaisshbinibiliroselleparurusahankumatokdagatplasakombinationiniibigmalikotnasanalaskagandacoalmedyopogiipinasyangmejopasigawsonidokelanboholpetsangsinagotpinatidlossbeginningsiatfchildrenharapmrsindustrypeacemegetmesangcardspeechessellmagpuntareboundestarfiadawnakarinigeconomyelectiondeldaancondostevemurangfreelancergueststryghednatingalahoweverstudiedvistrainingtargetpapuntabeenmapakalipasswordbornuniquebabaprocessamazoneffectreadinterviewingnotebookcountlessflyrawbitawanpasangknowsbadendbirthdayuniversalbinilingikinalulungkotngumitikomedornanahimiknananaghilinaghihiraptahimiktog,usuarionaninirahanbilitangangraphicreachsiyamargueseniorencompassesburmaalas-dosguiltymagta-taxiipagtimplanagtaasserviceswhynakapaligidbagkusnaglalakadna-fundincluirlabornakasumagotbreaksatisfactionexpectationsfraomelettepootbarangayphilippinemakapangyarihangkalalakihanalas-diyeskasuutanpagtutolmarurumipagpapatubonagkakakainanumangaustralianagtagpobotongnapakamethodsexplainquicklyalignsoffentlighimselfiiwanpundidocultivationcualquierengkantadangressourcernenagpapaigibpangyayariitokarunungandahan-dahancarsnagtutulakpacienciaibat-ibangkumidlatnawawalainspirationsurveysalanganpinansinpersoninspirebanlagentertainmentbunutanahasbrasoantoksellingpalayaniya