Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

100 sentences found for "not"

1. "A house is not a home without a dog."

2. "Dogs are better than human beings because they know but do not tell."

3. "Dogs are not our whole life, but they make our lives whole."

4. A father's presence and involvement can be especially important for children who do not have a father figure in their lives.

5. Additionally, be aware that not all opportunities on the internet are legitimate, so always do your own research before investing time or money into any opportunity

6. All these years, I have been learning to appreciate the present moment and not take life for granted.

7. Baby fever can evoke mixed emotions, including joy, hope, impatience, and sometimes even sadness or disappointment if conception does not occur as desired.

8. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

9. Cancer can impact not only the individual but also their families and caregivers.

10. Cheating is not always intentional and can sometimes occur due to a lack of communication or understanding between partners.

11. Einstein was a critic of quantum mechanics, famously declaring that "God does not play dice with the universe."

12. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

13. Foreclosed properties may require a cash purchase, as some lenders may not offer financing for these types of properties.

14. Forgiveness is not always easy, and it may require seeking support from trusted friends, family, or even professional counselors.

15. He also believed that martial arts should be used for self-defense and not for violence or aggression

16. He believed that martial arts was not just about physical skills, but also about mental and spiritual development

17. He could not see which way to go

18. He does not argue with his colleagues.

19. He does not break traffic rules.

20. He does not play video games all day.

21. He does not waste food.

22. He does not watch television.

23. He is not driving to work today.

24. He is not having a conversation with his friend now.

25. He is not painting a picture today.

26. He is not running in the park.

27. He is not taking a photography class this semester.

28. He is not taking a walk in the park today.

29. He is not typing on his computer currently.

30. He is not watching a movie tonight.

31. He was warned not to burn bridges with his current company before accepting a new job offer.

32. Hendes skønhed er ikke kun ydre, men også indre. (Her beauty is not just external, but also internal.)

33. Hun er ikke kun smuk, men også en fascinerende dame. (She is not only beautiful but also a fascinating lady.)

34. I am not enjoying the cold weather.

35. I am not exercising at the gym today.

36. I am not listening to music right now.

37. I am not planning my vacation currently.

38. I am not reading a book at this time.

39. I am not teaching English today.

40. I am not watching TV at the moment.

41. I am not working on a project for work currently.

42. I can tell you're beating around the bush because you're not looking me in the eye.

43. I do not drink coffee.

44. I don't know if it's true or not, so I'll take it with a grain of salt until I have more information.

45. I heard that he's not trustworthy, so I take everything he says with a grain of salt.

46. I know we're behind schedule, but let's not cut corners on safety.

47. I know you're going through a tough time, but just hang in there - you're not alone.

48. I'm not a big drinker, but once in a blue moon, I'll have a glass of wine or a cocktail with friends

49. I'm not going to pay extra for a brand name when generic options are a dime a dozen.

50. I'm not impressed with his art. Paintings like that are a dime a dozen.

51. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

52. If you did not twinkle so.

53. It is important to be patient and persistent, and to not get discouraged if you encounter obstacles along the way

54. It's not wise to burn bridges in the professional world - you never know when you might need someone's help in the future.

55. It's not worth getting worked up over - it's just a storm in a teacup.

56. It’s risky to eat raw seafood if it’s not prepared properly.

57. Just because she's quiet, it doesn't mean she's not intelligent - you can't judge a book by its cover.

58. Just because someone looks young, it doesn't mean they're not experienced - you can't judge a book by its cover.

59. Kumunot lang ang noo ko, That's not my name.

60. Let's not ignore the elephant in the room any longer and confront the issue head-on.

61. Let's not make this into a big deal - it's just a storm in a teacup.

62. Many people think they can write a book, but good writers are not a dime a dozen.

63. My friend was better off not knowing about her boyfriend's infidelity - ignorance is bliss, or so they say.

64. No hay peor ciego que el que no quiere ver. - There's none so blind as those who will not see.

65. Not only did he crash my car, but he also tried to blame me for it. That just added insult to injury.

66. Not only that; but as the population of the world increases, the need for energy will also increase

67. Oscilloscopes can measure not only voltage waveforms but also current, frequency, phase, and other parameters.

68. Pneumonia can be life-threatening if not treated promptly.

69. She does not gossip about others.

70. She does not procrastinate her work.

71. She does not skip her exercise routine.

72. She does not smoke cigarettes.

73. She does not use her phone while driving.

74. She is not cooking dinner tonight.

75. She is not designing a new website this week.

76. She is not drawing a picture at this moment.

77. She is not learning a new language currently.

78. She is not playing the guitar this afternoon.

79. She is not playing with her pet dog at the moment.

80. She is not practicing yoga this week.

81. She is not studying right now.

82. Some people argue that it's better not to know about certain things, since ignorance is bliss.

83. That article might not be completely accurate, so take it with a grain of salt.

84. The 10th Amendment of the Constitution outlines this division of power, stating that powers not delegated to the national government are reserved for the states

85. The baby is not crying at the moment.

86. The birds are not singing this morning.

87. The chef is not cooking in the restaurant kitchen tonight.

88. The children are not playing outside.

89. The children do not misbehave in class.

90. The dancers are not rehearsing for their performance tonight.

91. The dog does not like to take baths.

92. The elephant in the room is the fact that we're not meeting our sales targets, and we need to figure out why.

93. The flowers are not blooming yet.

94. The novel might not have an appealing cover, but you can't judge a book by its cover - it could be a great read.

95. The students are not studying for their exams now.

96. The sun does not rise in the west.

97. The sun is not shining today.

98. The teacher does not tolerate cheating.

99. The Tortoise and the Hare teaches a valuable lesson about perseverance and not underestimating others.

100. These jobs may not pay a lot, but they can be a good way to make some extra cash in your spare time

Random Sentences

1. Kapag mayroong hindi malinaw na impormasyon, madalas na nagkakaroon ng agam-agam sa mga tao.

2. Nasa harap ng pinto ang dalawang aso.

3. Bagay na bagay sa kanya ang suot na traje de boda.

4. Ano-ano ang mga nagbanggaan?

5. My husband surprised me with a trip for my birthday, and I couldn't be happier.

6. Hanap-buhay niya ang himayin ang mga buto mula sa bulak at gawing sinulid ang bulak.

7. Omelettes are a popular choice for those following a low-carb or high-protein diet.

8. Ang laki ng wedding cake na ginawa ng kanyang ate.

9. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

10. Mas maganda kung magbigay tayo ng oras at atensyon sa mga kabuluhan kaysa sa mga kababawan.

11. At ako'y namulat sa hubad na katotohanan.

12. Sa loob ng aking dibdib, nagliliyab ang poot na pilit kong iniipon.

13. Kina Lana. simpleng sagot ko.

14. Sa trapiko, ang mga traffic lights at road signs ay mga hudyat na nagbibigay ng tagubilin sa mga motorista.

15. Tumitingin kami sa mapa para alamin ang mga shortcut papuntang eskwela.

16. I have received a promotion.

17. Mababa ang tingin niya sa sarili kahit marami siyang kakayahan.

18. Hindi umimik si Aling Marta habang minamasdan ang bata.

19. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

20. At leve med en god samvittighed kan hjælpe os med at opbygge stærke og tillidsfulde relationer med andre mennesker.

21. Sino ang kasama ng ate mong naglakad kahapon?

22. For eksempel kan vi nu få adgang til tusindvis af film og tv-shows på vores telefoner og computere, og vi kan styre vores hjem med en app på vores telefon

23. Basketball players are known for their athletic abilities and physical prowess, as well as their teamwork and sportsmanship.

24. Ano ang nasa bulsa ng bag niya?

25. Sabay nanaog at pumitas ng halaman sa hardin at nagtuloy sa ilog upang pagmasdan ang bulaklak sa kanyang buhok.

26. Si daddy ay malakas.

27. Hindi dapat asahan na madaling makakuha ng tagumpay kung mailap ang pag-asa.

28. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

29. Buti naman. Ayoko mahawaan ng kuto eh.

30. Si Lolo Pedro ay pinagpalaluan ng kanyang mga apo dahil sa kanyang mga kwento at payo.

31. Danske virksomheder, der eksporterer varer til USA, har en betydelig indvirkning på den amerikanske økonomi.

32. Sa anong materyales gawa ang bag?

33. LeBron James is an exceptional passer, rebounder, and scorer, known for his powerful dunks and highlight-reel plays.

34. Pilit mang hinila ng prinsipe ang kamay ay di nito magawang makawala sa pagkakahawak ng prinsesa.

35. Nang malapit na siya, nagtatakbo ang dalaga at nawalang parang bula.

36. The patient was advised to quit smoking, which is a risk factor for high blood pressure and other health problems.

37. I know I should have started studying earlier, but better late than never, right?

38. We have completed the project on time.

39. Il n'y a pas de méthode unique pour maintenir la motivation, car chaque individu est différent et doit trouver ce qui fonctionne le mieux pour lui.

40. Sa sinabi nyang yun napalingon ako ng hindi oras, Ha?!

41. Ayaw niya ng mga maarteng bagay kaya hindi siya mahilig sa mga mamahaling gamit.

42. Ang tulang ito ay may petsang 11 Hulyo 1973.

43. Después de haber viajado por todo el mundo, regresé a mi ciudad natal.

44. This house is for sale.

45. Gusto ko sanang bumili ng bahay.

46. Ok. Alam mo, isa pa yung excited na magka-apo eh.

47. Nami-miss ko na ang Pilipinas.

48. It has revolutionized the way we communicate, allowing us to talk to people anywhere in the world at any time

49. I woke up early to call my mom and wish her a happy birthday.

50. The momentum of the athlete propelled him across the finish line.

Similar Words

notebooknothingnagpakunotKumunotnakakunot-noongmagpapabunotanother

Recent Searches

mataraynotmatandang-matandamatalikmastermassachusettsmaskinermasikmuramasarapmarkedsekonomimapangasawamapahamakmapag-asangmangiyak-ngiyakmalamanmakipagtagisanmakatarungangmakapagpigilmakalapitmakalabasmakakasahodmajoruugud-ugodmaipapamanamahigpitmahawaanmahalagamagsungitmagsasakamagsalitamagpuntamagpahingamaglaromaglalabing-animmagkasamangmagkakapatidmagisingmaghatinggabimagdamaganmagbungamagbibiladmagandang-magandamagalitmagalangmagagalingmag-isangmag-ibamag-galasanmaduromademaawaingmaalalalumuhodlumayaslumabanluluwaslucylot,longlivelimitlimahanlikelyleolendinglender,lendledleadlayaslaslargerlapatlamang-lupalalabhanlakinglaganaplabinsiyamkuyakuwebakuwartongkuripotkunekumitakumikiloskumaliwakumakapitkumakapalkumakalansingkulungankulisapkubokotsekontratakonsiyertokonsentrasyonkongresokomunikasyonknow-howknightklimakinikitakinauupuankinatatalungkuangkinalilibingankinakailangankinakilaykenjikenditalakelankeepingkaysakauna-unahangkatolikokatibayangkatagalkastilangkastilakasiyahankapasyahankantocompletingkandidatomakatulogkanankalakikaibigankahaponkahalumigmigankagatolkaedadnakakulongkabutihankabundukankaano-anojudicialjobsjingjingjenaiyonitimisaipinahamakipinagdiriwangiparatingipaliwanagipagmalaakiinternetinternacionalinteractinteligentesindividualsindividualincreasedincluirinalalayaninalagaanimproveimportantesimportanteimporimbesimagingilogbaketiiwaniatfpedenghvorhundredhumahagokhotelhjemhistoriashinoghinihilinghinanakitgregorianogreatlyhimiggovernorsgoodeveninggloriagiyeragetgenerosityfysik,fundrisefull-timefulfillingneedsfremtidigefreelancerflereflavioflamencofitness