Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

3 sentences found for "gathering"

1. Coffee shops and cafes have become popular gathering places for people to socialize and work.

2. The king's court is the official gathering place for his advisors and high-ranking officials.

3. This can include reading other books on the same topic, interviewing experts, or gathering data

Random Sentences

1. Sige. Heto na ang jeepney ko.

2. Les neuroscientifiques étudient le fonctionnement du cerveau et du système nerveux.

3. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

4. Sino-sino ang mga inimbita ninyo para manood?

5. Después de ver la película, fuimos a tomar un café.

6. Kebahagiaan sering kali tercipta melalui perspektif positif, menghargai hal-hal sederhana, dan menikmati proses hidup.

7. Papunta na ako dyan.

8. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

9. Sa dagat, natatanaw ko ang mga ibon na lumilipad sa malawak na kalangitan.

10.

11. Instagram has become a platform for influencers and content creators to share their work and build a following.

12. Ang pagpapakalat ng mga maling impormasyon ay nagpapakita ng pagiging bulag sa katotohanan.

13. Ang sugal ay isang hindi maiprediktable na aktibidad na nagdudulot ng excitement at thrill sa mga manlalaro.

14. Basta may tutubuin ako, lahat ay areglado.

15. Ailments can have an economic impact on individuals and society, including healthcare costs and lost productivity.

16. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

17. Nangagsibili kami ng mga damit.

18. Mathematical concepts, such as fractions and decimals, are used in daily life, such as cooking and shopping.

19. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

20. Limitations can be a result of societal or systemic inequalities and discrimination.

21. Sa pagtatapos ng seminar, ang mga dumalo ay nag-aapuhap ng mga kopya ng mga presentasyon.

22. Ang kulay asul na saranggola ay sumayaw sa bughaw na langit.

23. Many financial institutions, hedge funds, and individual investors trade in the stock market.

24. Online learning platforms have further expanded access to education, allowing people to take classes and earn degrees from anywhere in the world

25. Baro't saya ang isusuot ni Lily.

26. Ang mais ay tumutubo nang mabuti sa mainit na panahon, at dapat mong panatilihin ang lupa malambot at madulas sa pamamagitan ng regular na pag-irrigate

27. La creatividad nos lleva a explorar nuevos caminos y descubrir nuevas posibilidades.

28. La paciencia es la clave para conseguir lo que deseamos.

29. Magaling sumayaw ng Tinikling si Gabe.

30. Wag mo na akong hanapin.

31. Lumabas na rin naman ako pagkatapos.

32. La privacidad en línea es un tema importante que debe ser considerado al navegar en internet.

33. Madalas na mayroong propaganda sa panahon ng digmaan upang mapalawak ang suporta ng mamamayan.

34. Pupunta si Mario sa tabing-dagat sa hapon.

35. El cine es otra forma de arte popular que combina la actuación, la música y la narración visual.

36. Mas mainit sa Pilipinas kaysa dito.

37. Eh? Considered bang action figure si spongebob?

38. Alas-diyes kinse na ng umaga.

39. La agricultura es una carrera honorable y vital que ha existido desde tiempos antiguos.

40. Pakibigay sa akin ang listahan ng mga paalala bago ako maglakbay.

41. Ultimately, Christmas is a time of unity and togetherness, bringing people of all backgrounds and beliefs together to celebrate the spirit of love and hope.

42. He has bigger fish to fry

43. Muchas empresas utilizan números de teléfono de línea directa o números de call center para brindar soporte técnico o atención al cliente

44. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

45. Hihiramin ko ang iyong tools para sa aking proyekto sa bahay.

46. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

47. Esta comida está bien condimentada, tiene un buen nivel de picante.

48. Supergirl, like Superman, has the ability to fly and possesses superhuman strength.

49. Sa Sabado ng hapon ang pulong.

50. Nasa Ilocos si Tess sa Disyembre.

Recent Searches

gatheringtaingaseriousipatuloyalamidmalasutlacapitalbinabaliklasingerorestawanlulusognilinisnagbungatendermemorialchoicebusyangpressresultiosbaditinaliworldpinunittrackginisingagam-agamgraduallymakesinteriorthoughtsrawitinuringfatalcandidateworkdayinilinganyokampanaPINTOhalakhakwithouttutorialsnapilingtindigcertainipinalitdoingpackagingnutsviewfirstPASKOexpectationspagpapatubonapatakboewanpartieskabutihantinuronagkakakaindiwatapaaralannoelbatonakakapagodkumampimagkasakitpwededrinksdilagnagsasabingnaiinisbiglamanakboGUSTObarangaypopcornpinapagulongginoo1000relodisyembrelondonleftartehimselfenteralignstypeshinipan-hipannaninirahanmakapangyarihangnamumulaklakmakapangyarihannakikini-kinitanahuhumalingpamilyangpagpapasansasayawinnalalamanpagkamanghanagpasyaneverambisyosangkalalaromawawalamahihirappamilihannakaririmarimmasayahinbefolkningen,gulataiddropshipping,nanalopuntahanyakapinhulusumusulatpahiramtemparaturapambatangnakakatandatumindigbinitiwanpersonastiyakkailanmannanonoodgumuhitkommunikerergiyerabuwenaswikakababalaghangmanalomagtanimuwakligayapagsusulitkalabanunanitinaobkamalianexperience,siracalidadminahangasmenumigibmaghapongnuevomatulunginhinanapinalagaandomingonararapatkasamatenerbrasoniyanupuano-orderbinibilimadalingisinawakmeronpitumpongnatalonguntimelyaksidentepinaglagablabproudnenainiintayyeyskyldessignreguleringaudiencebumotofilmsbilisusulitartistsmeansroonpinauwikantobusloyepsipamapaibabawabrilsinknunolintatilllarger