Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Holy Week is a time of introspection and reflection, as Christians remember the sacrifice of Jesus and contemplate the meaning of his teachings and message.

2. Ang pagtulong at pagtutulungan ng mga komunidad ay mahalaga upang masiguro ang kaligtasan at pag-angat mula sa pinsala ng buhawi.

3. Sa paaralan, mahigpit na ipinagbabawal ang anumang uri ng abuso laban sa mga mag-aaral.

4. Ang kanyang galit ay parang nagbabaga, handang sumiklab anumang oras.

5. Det er også vigtigt at sætte et budget og begrænse sin risiko for at undgå at miste mere end man har råd til.

6. May biyahe ba sa Boracay ngayon?

7. Bigla ang pagbabago ng anyo ni Magda at Damaso.

8. Ngayon ka lang makakakaen dito?

9. Ang panitikan ay nagpapahayag ng mga damdamin at karanasan ng mga tao, at ito ay isang paraan ng pag-awit ng kanilang mga kuwento.

10. Los powerbanks se han convertido en un accesorio imprescindible para muchas personas que dependen de sus dispositivos electrónicos.

11. Hindi sapat ang maging bukas palad lamang sa panahon ng kapakanan, dapat bukas palad ka rin sa panahon ng kahirapan.

12. ¿Cómo te va?

13. The wedding reception is a celebration that usually follows the wedding ceremony.

14. Las fiestas invernales, como el Día de Reyes, traen alegría y celebraciones.

15. The origins of many Christmas traditions can be traced back to pre-Christian times, such as the use of evergreen trees and wreaths.

16. Il est important de savoir gérer son argent pour éviter les problèmes financiers.

17. En la realidad, las cosas no son siempre en blanco y negro.

18. A veces la realidad es dolorosa, pero no podemos escapar de ella.

19. Sa aming pagdiriwang ng buwan ng wika, nagkaroon kami ng pagtatanghal na nagpapakita ng kahalagahan ng bayanihan.

20. Walang kasing bait si mommy.

21. El internet es una herramienta muy útil que nos permite acceder a una gran cantidad de información.

22. Gracias por hacer posible este maravilloso momento.

23. Different types of stocks exist, including common stock, preferred stock, and penny stocks.

24. Maiiwasan ang bungang-araw kung paliligo nang regular.

25. The United States is the world's largest economy and a global economic superpower.

26. James A. Garfield, the twentieth president of the United States, served for only 200 days in 1881 before his assassination.

27. Ang paglapastangan sa kalayaan ng pamamahayag at malayang pagpapahayag ay isang pagkitil sa ating demokratikong prinsipyo.

28. Eto isuot mo. binigay ko sa kanya yung dress na binili ko.

29. Anong oras ho ang dating ng jeep?

30. Hindi na nakarating ang mensahe ni Andy sa kanyang ina.

31. It's considered bad luck to say "good luck" to an actor, so instead we say "break a leg."

32. Nung natapos yung pag print, nakita nung babae yung pictures.

33. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

34. But the point is that research in the field of the development of new energy sources must be carried on further and expedited so that the exhaustion of conventional sources of power does not adversely affect the growth of our economy and the progress of civilization

35. He is watching a movie at home.

36. Walang anuman saad ng mayor.

37. Hala, change partner na. Ang bilis naman.

38. Ang droga ay hindi solusyon sa mga suliranin ng buhay, kundi dagdag pa itong suliranin.

39. Tila may bumisita sa bahay kagabi dahil may bakas ng paa sa labas.

40. Maganda ang website na ginawa ni Michael.

41. Dedicated teachers inspire and empower their students to reach their full potential.

42. La labradora de mi primo es muy protectora de la familia y siempre está alerta.

43. Ang tunay na kaibigan ay maasahan sa oras ng kagipitan.

44. Magkano ito?

45. Nagpaluto ang nanay ko ng adobo sa akin.

46. Lazada's parent company, Alibaba, has invested heavily in the platform and has helped to drive its growth.

47.

48. Trending topics on Twitter show the most popular and widely discussed subjects at a given time.

49. Tumingala siya ngunit siya'y nasilaw.

50. Ang mailap na kahulugan ng salita ay kailangan unawain nang mabuti.

Recent Searches

babescriticschoiceasulresultadistanciasakalingkayaenergiilantubig-ulanresearch:ngisipookkagandahagtusongnangahasmagkaharapworkingctilesobservation,sakyanmaibaliknaliwanagantinakasanhalu-halonapasubsobnapapansinnagwalisskyldesbilanggoalasnapakatalinostoreupworkanimmagagandangnagmadalingsasagotnakagagamotactionmagkakasamapagtatanghallingidexpressionsiwinasiwashinoggarbansosawitinautomationmanakbopopcornbestidapawislumuwasenglishkumidlatfreelancernagtataaspagsisisibinatoedukasyonnakatayoomfattendeeuphoricnoongvelstandawang-awahayopsilid-aralannakauposinabiherramientaniyogmakakawawapagtatanimmalulungkotyakapinnami-missh-hoyhitadiwatakumalmamahinamasayahinpinag-aaralankapamilyajokemaitimmayopedrolargerbugtongjudicialroomsakinkerbulamallottedcupidhahahamagawamaghilamosnaiinisnatitiyaktiyaknakarinigfulfillmentnahigitaniiwasankumampinagsamalansanganbinigaydietpieceskain1000iniinomresumensalarinpangingimisigehusotinanggaparguelalabagkus,pagsalakaymagbabakasyonmagbagong-anyopagluluksacultivopunongkahoynaninirahanmakikitasponsorships,paglalabadadahan-dahannakayukocultivarmagkaibakinabubuhaynagmakaawamakikipaglaropagsumamotinatawagnanahimikerhvervslivetnagpapaigibpaki-chargengumingisimagkasakitvideoscorporationusuariorektanggulonatuwamangyarilabinsiyamtotoongkamiaskontratakongresonegroshumigabayangalagaanilanagdaosngipingumuposunud-sunodibabawkundimanbunutanjeepneymakisuyonagpatuloysapatkontingbuhokestateinakyatdasalmaghintaycalidaddreamskainisjuanmatikmansisidlanpaskongsusulitbilibltomulighederelectoraleducationayaw