Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Alam ko na hindi maganda ang agam-agam ko, kaya kailangan kong magsumikap upang malunasan ito.

2. La crisis económica produjo una gran inflación que afectó a los precios.

3. Napakaganda ng bansang Pilipinas.

4. Pinking shears are scissors with zigzag-shaped blades used for cutting fabric to prevent fraying.

5. Joshua, kumusta ang pakiramdam mo?

6. Me duele el estómago. (My stomach hurts.)

7. Sumakit ang tiyan ko kagabi kaya ako ay biglaang nagka-sick leave.

8. Kasama ng kanilang mga kapatid, naghihinagpis silang lahat sa pagkawala ng kanilang magulang.

9. The United States has a national motto, "In God We Trust," and a national anthem, "The Star-Spangled Banner."

10. They have already finished their dinner.

11. The use of emphasis is influenced by cultural and social norms.

12. Sueño con tener mi propia casa en un lugar tranquilo. (I dream of having my own house in a peaceful place.)

13. Kucing di Indonesia juga terkenal dengan sifatnya yang suka tidur dan bermalas-malasan.

14. Ang mailap na mga bagay ay kailangan paglaanan ng oras at pagsisikap upang makamit.

15. The bride usually wears a white wedding dress and the groom wears a suit or tuxedo.

16. El arte contemporáneo es una forma de arte que refleja las tendencias y estilos actuales.

17. No tengo apetito. (I have no appetite.)

18. Ang mga Pinoy ay may kakaibang hilig sa basketball at volleyball.

19. Some people find fulfillment in volunteer or unpaid work outside of their regular jobs.

20. Pasensya na, kailangan ko umalis ng maaga.

21. Magsasalita na sana ako ng sumingit si Maico.

22. ¿Te gusta el sabor picante del jengibre?

23. Napagod siya dahil magdamagan ang trabaho.

24. It is essential to approach the desire for a baby with careful consideration, as it involves lifelong responsibilities and commitments.

25. Elle adore les films d'horreur.

26. Le stress peut avoir des effets néfastes sur la santé mentale et physique.

27. Mahusay na mahusay kumita ng pera si Kablan.

28. Wala yun, gusto ko rin naman sanang pumunta dito eh.

29. Ipaghugas mo siya ng mga Maghugas ka ng mga

30. Hindi maganda ang epekto ng laging pagmamangiyak-ngiyak dahil nakakasira ito ng morale at nakakapagpababa ng confidence.

31. Natapos ko ang aking trabaho sa opisina sa hatinggabi dahil marami akong backlog.

32. Gusto kong namnamin ang katahimikan ng bundok.

33. The team's games are highly anticipated events, with celebrities often seen courtside, adding to the glamour and excitement of Lakers basketball.

34. Many politicians are corrupt, and it seems like birds of the same feather flock together in their pursuit of power.

35. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

36. Tulala siya sa kanyang kwarto nang hindi na umalis ng buong araw.

37. Lumaking masayahin si Rabona.

38. Me siento cansado/a. (I feel tired.)

39. Nagtatanim ako ng mga flowering plants upang magkaroon ng magandang tanawin sa paligid.

40. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

41. Limitations can be perceived or real, and they can vary from person to person.

42. Sa kabila ng hirap, ang kanyang loob ay hindi kailanman naging mababa.

43. Las pinturas abstractas pueden ser interpretadas de diferentes maneras por el espectador.

44. Mi sueño es tener éxito en mi pasión por la moda y el diseño. (My dream is to succeed in my passion for fashion and design.)

45. Some fruits, such as strawberries and pineapples, are naturally sweet.

46. James K. Polk, the eleventh president of the United States, served from 1845 to 1849 and oversaw the Mexican-American War, which resulted in the acquisition of significant territory for the United States.

47. Ipinahid ni Nanay ang gamot sa bungang-araw ng anak.

48. Tengo tos seca. (I have a dry cough.)

49. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

50. En tung samvittighed kan nogle gange være et tegn på, at vi har brug for at revidere vores adfærd eller beslutninger.

Recent Searches

abikumakapitnitongcriticsdagapingganchoicenakapuntaminamahaleksamlayuninmapapahoweverfascinatingnalangpublishingpasswordpinalakingcoinbasepalagingcoachingauditstrategyadventpagtatakaadvertisingdadalawinnagkitapatientcountlesssummitimprovedinternaactionanimstreamingumarawnagginghimselfhelpfulpeterbringaidchefschoolnamumulotlibrengmemoryexplainiginitgitadaptabilityinteractmagsaingworkshopstyreralignspackagingplatformanotherallowedreallykapatidmatsingmatabapromotebilihinenergisinapokbilhinnahantadpopulardamitpinapakiramdamancertainkinantasinapittatagalpinisilpalakolkabilisnangumbidamagpakasalindividualpagbabayadmadalingsandwichbumisitakumaliwaililibresinalansankamakailanbagamatnanangiskabiyakpinapalotoopwestonapapatungoisinagotgymkanayangpalamutipapanhikpasensyaculturalvariouspresencebabasahinnagagamittaon-taonmangahasinspirasyonmagsugalnagwalismapaikotkinagalitanbiyernesconcernsmanghikayatpagbabagong-anyobalitanahuhumalingnangangambangeuphoricprojectsbasedkusinayumabongprovidedexpressionsnakapapasongsalitangincitamenterfacilitatingliv,hinimas-himasnalagutanentrancehahahatig-bebentehumahangoskinagagalakpagpapakilalakonsultasyonpagkaimpaktonakatunghaytienenhanginlibrerightsbayansinamatumalalakkindlenagngangalangmakikitamakikipag-duetonagbabakasyonnapakatagalpresspagkakatuwaannakakapagpatibaynakuhahitakabundukansulyappinag-aaralannagreklamokare-karetungawnaiyakpaglakipaglisanmansanasproudbwahahahahahapagkaangathandaangovernmenthayaanmagkasamalinggongpilipinasnangahaspaghaharutanmagpalagoiloilonakakatandamumurapinasalamatankalarolaruinkanangkommunikererlilikonaaksidentebutikibuwiskilong