Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Naghanap siya gabi't araw.

2. Ang mapa ng mundo ay nagpapakita ng lahat ng mga bansa sa buong mundo.

3. Bagamat modernong panahon na, marami pa rin ang pumupunta sa albularyo sa kanilang lugar.

4. She has a strong social media presence, boasting millions of followers on platforms like Instagram and Twitter.

5. Pinapagulong ko sa asukal ang kamias.

6. Nagkakatipun-tipon ang mga ito.

7. Las personas pobres a menudo enfrentan discriminación y estigmatización en la sociedad.

8. Good morning. tapos nag smile ako

9. Paglingon niya, nakakita siya sa kanyang tabihan ng isang munting palaka na parang nakatinging sa kanya

10. Nagpagupit ako sa Eclipxe Salon.

11. Hindi ko malilimutan ang pagkanta namin ng "Hindi Kita Malilimutan" ng Bukas Palad sa aking graduation.

12. Ang sigaw ng matandang babae.

13. Bigla nya akong binato ng unan, H-hoy! Magtigil ka nga!

14. Medarbejdere kan deltage i mentorprogrammer for at forbedre deres færdigheder.

15. I've been following the diet plan for a week, and so far so good.

16. Medarbejdere kan arbejde på en sæsonmæssig basis, som landmænd.

17. Hindi mo alam kung maarte siya o hindi dahil hindi siya masyadong nakikihalubilo sa ibang tao.

18. Microscopes have played a critical role in the development of modern medicine and scientific research.

19. Ngunit nagliliyab pa rin ang poot sa kanyang mga mata.

20.

21. Napahinto kami sa pag lalakad nung nakatapat na namin sila.

22. Stay there. si Maico sa awtoritadong tono.

23. La pintura es una forma de expresión artística que ha existido desde tiempos antiguos.

24. Musk has been involved in various controversies over his comments on social and political issues.

25. Ang lilim ng kanyang payong ay nagsilbing proteksyon sa kanya mula sa matindi at biglang pag-ulan.

26. Ano ang ipinabalik mo sa waiter?

27. Recuerda cuídate mucho durante la pandemia, usa mascarilla y lávate las manos frecuentemente.

28. Sira ang aircon sa kuwarto ni Pedro.

29. She is not playing the guitar this afternoon.

30. AI algorithms can be used to create personalized experiences for users, such as personalized recommendations on e-commerce websites.

31. Les écoles offrent une variété d'activités parascolaires telles que le sport, la musique et le théâtre.

32. A couple of coworkers joined me for lunch at the cafe.

33. Facebook provides tools for businesses to create and manage advertisements, track analytics, and engage with their target audience.

34. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

35. Galit ng galit ang ama ni Bereti nang may nakapagsabi na namumulot at kumakain ng tirang pagkain ang anak.

36. My favorite restaurant is expensive, so I only eat there once in a blue moon as a special treat.

37. Ang haba na ng buhok mo!

38. Ang pag-asa ay nagbibigay ng lakas sa mga tao upang labanan ang mga hamon sa buhay.

39. Jouer de manière responsable et contrôler ses habitudes de jeu est crucial pour éviter des conséquences graves.

40. Work can also provide opportunities for personal and professional growth.

41. Nahuli na kahapon ang nagnakaw ng kalabaw ni Mang Arturo.

42. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

43. Itinapon nito agad ang nasabing bunga pagkatikim dahil sa sobrang asim.

44. Bumaba ako sa basement ng bahay at nagitla ako nang biglang mag-on ang ilaw.

45. Natawa ang bata ngunit pumayag din ito.

46. Mahilig siya sa pag-aaral ng mga klasikong akda ng panitikan.

47. I am absolutely committed to making a positive change in my life.

48. Malapit na ang araw ng kalayaan.

49. My boss accused me of cutting corners on the project to finish it faster.

50. She joined a charitable club that focuses on helping the elderly.

Recent Searches

wordschoicemethodsaffectwithoutbehindanotherdividesimagingbeforestowonderkutodmaglalakadriyankumbinsihinmatalinomagtataassharenakahantadromanticismodalawangsisidlankitinterestsgutompakakasalannumerosasbinabalikdingginalinmungkahipowersreleasedoffentligabsdilimtipidlumakileaderstemparaturaforskel,inasikasoyoutube,kaninumanbiologinangyaripasyentemahinatinawagpagsahodtengaganunhumpay3hrsbayangkumaenmasarappinaghinabolexpresanparoroonabuwayainakalangnakadapapalabuy-laboymaliksidapit-haponsasayawinwaaadonemagingrichjamesbiroformasmulalet-shirtikinasasabikkwenta-kwentanagtutulungannangagsipagkantahanjejupagbigyannagtataepuntahankolehiyonagpalutopagbebentamasaktannakablueevolucionadotumamismagsisimulalalopanunuksokamaliansakennilaosbinitiwantienennakarinignaguusaptagpiangmasaholsinehanskyldessimplengulinginsteadpuntatoolrefnayonsakoplumbaymanonoodkumaineroplanobanalkumukulonahigasaraalaskayamasipaginalagaanagadhousekalakingnakapuntatshirtpogialamidmayoklimakamatisspeechesasullamanerrors,pacepaghaliktoylabasleftbolabuhayunti-untingpumulotniyonnaiilangisa-isastonehampasalubongtarangkahanformpag-uwimataraynakakapagtakakasihiramlending:gagamitmatumalmaingatpalaisipanelepantenakangisihiniritsabadongpaglalabadapanghabambuhaymangeparusanakakagalingnagkakasyamagnakawmang-aawitrenombreinilabasnagtagisansportsginhawanandayamasaksihannangahasmumuntingmovieihahatidnagkwentotumutubobayawakselebrasyondrowingakinngumingisimaanghangpagbabayad