Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. She admires the philanthropy work of the famous billionaire.

2. Pagkatapos nyang maligo ay lumuwas na ito ng maynila.

3. Ang saranggola ay simbolo ng kasiyahan noong kabataan.

4. They were originally established in 1947 as the Minneapolis Lakers before relocating to Los Angeles in 1960.

5. The website's contact page has a form that users can fill out to get in touch with the team.

6. Sa pagkakaroon ng pagkakamali, hindi maiwasang maglabas ng malalim na himutok.

7. Microscopes are also used in materials science and engineering to study the microstructure of materials.

8. Beber suficiente agua es esencial para una alimentación saludable.

9.

10. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

11. Hindi maikubli ang panaghoy ng bata habang nilalapatan ng lunas ang sugat niya.

12. Ang mga litrato ay mahalagang bahagi ng kasal upang maalala ang espesyal na araw.

13. Les personnes qui manquent de motivation peuvent être découragées et avoir des difficultés à accomplir leurs tâches.

14. Sinabi naman ni Apollo ang mga dapat gawin.

15. Hinagud-hagod niya ang mga kamao.

16. Additionally, there are concerns about the impact of television on the environment, as the production and disposal of television sets can lead to pollution

17. Humarap sakin si Nathan, Kumain na ba kayo?

18. Saan ka galing? bungad ni Maico saken pagpasok ko s condo.

19. Sa pagbisita niya sa museo, pinagmamasdan niya ang mga antique na kagamitan.

20. The dancers are not rehearsing for their performance tonight.

21. Kailangan nating mag-ingat sa kalusugan upang maiwasan ang mga sakit, samakatuwid.

22. The patient was advised to follow a healthy diet and lifestyle to support their overall health while undergoing treatment for leukemia.

23. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

24. Sa pagkakaroon ng kalamidad, ang mga biktima ay nag-aapuhap ng emergency relief mula sa mga rescue teams.

25. Sa aking balkonahe, natatanaw ko ang pagsikat ng araw sa silangan.

26. Anong oras natutulog si Katie?

27. Después del nacimiento, el bebé será evaluado para asegurarse de que está sano y para determinar su peso y tamaño.

28. Ang mga bayani ay nagpapakita ng matapang na paglaban laban sa pang-aapi at kawalang-katarungan.

29. Lumampas ka sa dalawang stoplight.

30. Ang kalayaan ay hindi dapat magresulta sa pagpapahirap sa ibang tao.

31. Nous avons eu une danse de mariage mémorable.

32. Kapag umuulan, hindi puwedeng maglaba ng mga damit sa labas.

33. En helt kan være enhver, der hjælper andre og gør en positiv forskel.

34. Si Josefa ay maraming alagang pusa.

35. Was du heute kannst besorgen, das verschiebe nicht auf morgen.

36. Some Christians participate in fasting, prayer, and other spiritual practices during Holy Week as a way of deepening their faith and connection to God.

37. Les personnes ayant des antécédents de dépendance ou de problèmes de santé mentale peuvent être plus susceptibles de développer une dépendance au jeu.

38. Cancer can be diagnosed through medical tests, such as biopsies, blood tests, and imaging scans.

39. May email address ka ba?

40. The river flows into the ocean.

41. Habang naglalakad siya, nakita ko siyang tulala sa kanyang cellphone.

42. Wala yun. Di ko nga naisip na makakatulong. aniya.

43. Malamig na pawis ang gumigiti sa kanyang noo at ang tuhod niya ay parang nangangalog.

44. Matutulog ako mamayang alas-dose.

45. Nakita niyang lumalakad palayo ang kaibigan, na tila may tinatago.

46. Det er en metodisk tilgang til at forstå verden omkring os og finde årsager til de fænomener, vi observerer

47. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

48. Musk's legacy may have a significant impact on the future of technology, sustainability, and space exploration.

49. We have been painting the room for hours.

50. Le marché boursier peut être un moyen de faire fructifier son argent.

Recent Searches

choiceabiwesleyelectionswatchingsumasambaeksamenfurysumalamalimitcuredalisbelievedsimuleringerchessstyreearlyexperiencesmamibobreservationkungaidipaalamviewspsychepositioneretoideafatalmosttoocommunicationipasokvisualiparatingwithouteducatingmarurusingakingdingcementedstreamingfredneedguiltyisugaandoymaalwangsingsingsouthdalagasigawamerikanagcurveniyoglupaininiangatpinagkiskisprobinsiyakamukhadumaanpangkaraniwaninsidentemisyunerongaraw-arawmakilalalilikonagmateryalesmahigpitnapag-alamanmissyamantumalimmaglutomuntinlupadatakommunikerernapahintokabiyaknakaramdampakilagayihandaninaebidensyamaranasanvegaspuntahanipinatawagkamandagtaglagassicabecomingworddahankrussaydaramdaminginagawapagtawamahihirapnakuhakaharianlarryincluirkondisyonmedicalkissdenpasangbilerpasanmentalhereikatlongcontinuepublishedrougheitherparkingtooljackinternasafeapollomitigatemagbagokabilangnagreplybabaekalanbugtongso-calledkamisetangtinanggaplumiwagkumainnaglalakadpang-isahangmagkikitaalaalamukalumulusobpasigawbagayngingisi-ngisingpinakamatapatnakagalawnakapapasongformamakakawawamagbayadmakikiraanmagasawangkapiranggotnakangisipagpapakainnapakagagandatatlumpungskills,magbabayadcocktailmabagaliniuwidiyannearnakakatandamasaksihankakataposmakikiligovictoriatradisyonipinagbibilipwestouwakbilihinganidpasasalamatbinitiwankaybilisbanggainyarimaistorbomaubossantosdiseasenakakamanghaitinulostayokatulonge-commerce,annikabilhinconectadoscollectionsbinibiniconsistexitder