Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Magkaiba ang disenyo ng mga blusa namin.

2. Ang kanyang boses ay napakahinahon at mababa.

3. Matagumpay na nagwagi si Wesley laban sa kasalukuyang kampeon ng boxing.

4. Ipanlinis mo ng sahig ang basahan.

5. Make sure to keep track of your sources so that you can properly cite them in your book

6. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

7. Hun er min store forelskelse. (She's my big crush.)

8. Matagal akong nag stay sa library.

9. Las plantas suelen tener raíces, tallos, hojas y flores, cada una con una función específica.

10. Hindi ako pumayag na hiramin ang aking laptop sa aking kapatid dahil baka masira ito.

11. Pakibigay ng malinaw na paliwanag sa tanong upang mas madali itong maunawaan.

12. Marahas ang kanyang pagkakapagsalita sa bata at maaaring may kakilala siyang nagdaraan na nakarinig ng kanyang mga sinabi.

13. Ang bagong linis na kurtina ay nagbigay ng sariwang at mabangong hangin sa silid.

14. Ngunit sa lahat, siya ang may pinakalutang na kagandahan.

15. The Taj Mahal in India is a magnificent wonder of architecture.

16. Hindi dapat tayo magpaplastikan dahil mas makakabuti kung magiging totoo tayo sa isa't isa.

17. Larry Bird was a versatile forward and one of the best shooters in NBA history.

18. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

19. Sa panahon ngayon, napakahalaga ng mga taong bukas palad dahil sila ang nagbibigay ng pag-asa sa mga taong nangangailangan.

20. It's important to remember that April Fool's jokes should always be in good fun - nobody likes a prank that's mean or hurtful.

21. Der er ingen fastlagte regler for, hvordan man bliver kvinde, det er en individuel proces.

22. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

23. Microscopes have revolutionized the field of biology, enabling scientists to study the structure and function of living organisms at the cellular and molecular level.

24. Eine schlechte Gewissensentscheidung kann zu Konflikten und Schwierigkeiten führen.

25. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

26. I found a great recipe on a cooking website that I can't wait to try.

27. The members of the knitting club are all so kind and supportive of each other. Birds of the same feather flock together.

28. Nakaramdam na lang ako biglang may humampas ng ulo ko.

29. Las redes sociales son una parte importante de nuestras vidas hoy en día.

30. The investment horizon, or the length of time an investor plans to hold an investment, can impact investment decisions.

31. Maaaring magdulot ng pangmatagalang epekto sa kalusugan at kaligtasan ng mga tao ang digmaan.

32. Si Carlos Yulo ang naging inspirasyon sa pagbuhay muli ng gymnastics program sa Pilipinas.

33. Maging ang mga mahihirap na disenyo ay kaya ng gawin ng bata sa murang edad.

34. The amount of knowledge that exists in the world is immeasurable.

35. Hindi makapaniwala ang lahat.

36. Me gusta recolectar hojas secas en el parque y hacer manualidades con ellas.

37. Hindi ko akalaing capable ka palang tumawa.

38. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

39. With dedication, patience, and perseverance, you can turn your manuscript into a finished book that you can be proud of

40. Nakakapagpatibay ng buto ang calcium.

41. There were a lot of boxes to unpack after the move.

42. Nagmungkahi ang dentista na ipalinis ko na ang aking ngipin.

43. Gaano ka kadalas nag-eehersisyo?

44. Banyak orang Indonesia yang mengajarkan doa sejak usia dini, sebagai salah satu nilai-nilai agama dan moral.

45. Ang pagtulog ay isang mahusay na paraan upang makalimutan pansamantala ang mga alalahanin at stress.

46. Ilan ang telepono sa bahay ninyo?

47. The company's profits took a hefty hit after the economic downturn.

48. With the introduction of television, however, people could now watch live events as they happened, and this changed the way that people consume media

49. Kailan ba ang flight mo?

50. Proses kelahiran di Indonesia umumnya dilakukan di rumah sakit atau pusat kesehatan masyarakat (Puskesmas).

Recent Searches

paghahabichoicemarangalrelopaglayaspara-parang1787dumilatatetumutubonabighanidamasodisensyokundilihimkasamanoonglandbrug,agawendconclusionsinasagotinantokmerlindapaalampinatutunayannalamanmag-aralkoryentepalusotlapitanrestawanprogramatakotsumindiagam-agamabrilmanuelyelonaglulusakginawacapabletrabahocuandotahimikjosephlitokidlatteachernilayuankagandahannagcurvepagsisisimatamakulongmakapaibabawconcernnaliwanaganpekeanpuwedepwedemusicalespagsalakaymakasahoddaraananisinalaysaytaon-taonpulgadalagaslasproductionkinumutanpalanganak-pawispolonuclearnetosalu-salounamangyayarihaltmuliakmahmmmeditorumilingarawtawanangoalkumembut-kembotagaw-buhayestablisimyentoartepaladmatapanglabing-siyamisinamataposelijedepartmentinisa-isaaumentardinalatanggapinpag-isipanaraw-arawpumayagideyarichkasawiang-paladpagpapakalatmamimilitayolinyahuwebessharmaineevnecalciumpageantmananalopagtatanghalhindepalawancampaignsdulottissuealituntuninngumingisiiskonag-eehersisyomataasibilihagikgikpagtatapospagkakamalikinagathiwagaadvancementsnasarapanadvertising,kalawakanpamanminamahaladobonakiisagamottanghalititamakalaglag-pantylegislativeakalalalongpopulationpandemyasumibolmessagenagbigayanpag-iyakapatnaputamissurveysipinagbilingtumatawadnagrereklamomarasiganeverythingmamipracticestalinobagkus,pagbigyannakaprobinsiyakinalilibingankasiumokaythoughdaanafterkaraokemasasamang-loobhigittilakumulogbestidabadingriyanboksingkesovillagepilitliligawankatagaexpandedpagkapanalohinamonpioneerlegacypangalanpanalanginmensahe