Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Sa tradisyon ng kanilang kultura, isang malaking kaganapan ang pagpapakilala ng pamilya ng lalaki sa pamilya ng babae sa pamamamanhikan.

2. Guten Morgen! - Good morning!

3. Habang daan, samantalang patungo sa pamilihang-bayan ng Tondo, ay mataman niyang iniisip ang mga bagay na kanyang pamimilhin.

4. Debemos tener una buena comprensión de la realidad para tomar decisiones informadas.

5. Ano ang gagawin ni Trina sa Oktubre?

6. Sa pagpapakumbaba, maraming kaalaman ang natututunan.

7. El arte renacentista fue una época de gran florecimiento del arte en Europa.

8. When I'm traveling alone, I often join a group tour to break the ice and meet new people.

9. Bumisita kami sa mga kaibigan namin sa kanilang bahay sa hatinggabi.

10. Ang mga magulang niya ay pinagsisikapan ang magandang kinabukasan ng kanilang mga anak.

11. Nagbenta ng karne si Mang Jose kay Katie.

12. Sa bawat panaghoy ng mga nagugutom, pilit nilang itinataguyod ang kanilang pamilya.

13. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

14. Kapag may tiyaga, may nilaga.

15. La creatividad nos inspira y nos motiva a seguir adelante con nuestros proyectos.

16. Sigurado ka ba dyan, Kenji? tanong ng dad ni Athena

17. She admires her mentor's leadership skills and work ethic.

18.

19. Sa aking kasintahan, natatanaw ko ang pagmamahal na umaapaw sa kanyang mga mata.

20. Sa bawat pagkakamali, mayroong aral na pwedeng matutunan, datapapwat ay masakit ang mawalan ng pagkakataon.

21. Mabait sina Lito at kapatid niya.

22. They do not ignore their responsibilities.

23. La escultura de Leonardo da Vinci nunca fue tan famosa como su pintura.

24. Si Rizal ay kilala sa kanyang pagiging makatarungan at pagiging boses ng mga walang tinig sa kanyang panahon.

25. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

26. La música es una forma de expresión que puede ser utilizada para conectarnos con otros y compartir nuestras emociones.

27. Bakit hindi nya ako ginising?

28. Smoking is a harmful habit that involves inhaling tobacco smoke into the lungs.

29. Goodevening sir, may I take your order now?

30. Sa mga gubat ng Mindanao, may mga punong-kahoy na may napakalaking kahoy at tinatawag itong "Lauan".

31. The novel's hefty themes of love, loss, and redemption resonated with readers around the world.

32. Yumabong ang mga negosyo na mayroong social media presence dahil sa kanilang pagkakaroon ng mas malawak na market.

33. Naglabanan sila upang makita kung sino ang tatagal at mananaig.

34. Mathematics is a language used to describe and solve complex problems.

35. Hindi ko alam kung bakit hindi mo na gustong makipag-usap sa akin.

36. El agua dulce es un recurso limitado y debemos cuidarlo y utilizarlo de manera sostenible.

37. Ilang tao ang nagsidalo sa graduation mo?

38. Det er vigtigt at respektere og anerkende transkønnede personers kønsidentitet og bruge deres præfererede pronominer og navne.

39. The Getty Center and the Los Angeles County Museum of Art (LACMA) are renowned art institutions in the city.

40. Los héroes nos recuerdan que todos tenemos el potencial de marcar la diferencia en el mundo.

41. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

42. Women have shown remarkable resilience and strength in the face of adversity and oppression.

43. Riega el maíz regularmente y asegúrate de que el suelo esté siempre húmedo

44. Additionally, television news programs have played an important role in keeping people informed about current events and political issues

45. Football is a popular team sport that is played all over the world.

46. Tweets are limited to 280 characters, promoting concise and direct communication.

47. Paki-translate ito sa English.

48. Einstein's work challenged traditional notions of reality and paved the way for new and innovative approaches to understanding the universe.

49. El cambio de gobierno produjo una reorganización completa de las instituciones.

50. She studies hard for her exams.

Recent Searches

choicenakiisaneedswithoutmapeitherfallclassmateprotestainternaconsiderissuesscalecultivationmakakatakasbulongdejatinatawagkababaihankarununganguitarrayumaomagawasanganag-isipkawayancashpromotebeastganitosawasigepakainrosebumabagprobablementeamountlabaninitcurrentmaisnag-alalanagpuyosditomatalinomandukotkindergartenpanalanginmakulitnapansinprobinsiyamatalikpartnerkayabangankikitabagoganidriskgabi-gabipeacepagsalakayreadmuchasfraagavideolargerboksingtrafficpostcardandamingabonobriefgngoverviewlayuninipinalikelypollutionmapadalihalikagracebigpinunittabasbiocombustiblespinagmamalakipinagkaloobannamumukod-tangikumakalansingmakikiraankalakihanpagkuwapagkakayakapgayunmanmagnakawgeologi,pagpapakalatmagtiwalautak-biyarevolutioneretnaguguluhannapanoodumiiyaklumiwagmiyerkolesnapakagagandanakasahodtutungomungkahiarbularyobalahibopaghalikmensahegumawamakabilinaglokopagamutanbihirangvictoriabinuksandiferentessamantalanghouseholdmagawangtulisanmagdamagpasaherokongresohawaiitirangbumalikbarcelonapawispagmasdannatutulogpanginoonpambatangkirbycrametamarawhumihingibalitaidiomatelainfusionesnakabiladallepagpasokeleksyonkubotusongnagplaycurtainskutodpinatiraself-defensetugonnaalisaaisshdustpantomorrowtawareynainastanagpapakainginaganoongiverilocospalakainimbitalayawasiaticbulakkargangorganizehalamantsegrammarkatandaanpakilutonapatinginitutoldiscoveredtinioargueconsumepadaboggreatultimatelymanuscriptbinigayarbejderamparofonossolarmedidavehiclespalapitbehalf