Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Es útil llevar un powerbank cuando se viaja, especialmente en lugares donde no hay acceso a enchufes eléctricos.

2. Sige, tatawag na lang ako mamaya pag pauwi na ko..

3. Videnskab er systematisk undersøgelse af natur og universet ved hjælp af metoder som observation, eksperimentering og analyse

4. Ang tunay na pag-ibig sa bayan, ay hindi lamang sa panahon ng kaginhawahan.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. I need to check my credit report to ensure there are no errors.

7. Kumain ako sa kapeterya kaninang tanghali.

8. The blades of scissors are typically made of stainless steel or other durable materials.

9. Einstein's intellectual curiosity, creativity, and persistence in the face of challenges serve as a model for aspiring scientists and scholars.

10. Lumaganap ang hinagpis sa buong nayon nang malaman ang pagkasawi ng mga mangingisda sa bagyo.

11. Therefore, we should all steer clear of this bad habit of smoking cigarettes

12. Ang aming pagsasama bilang magkabilang kabiyak ay nagbibigay ng lakas at inspirasyon sa akin.

13. The Senate is made up of two representatives from each state, while the House of Representatives is based on population

14. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

15. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

16. Isang umaga habang siya ay naglalakad patungo sa kanilang hardin ay may nakasalubong niya ang isang binata.

17. Nagtawanan ang mga kaibigan, waring may alam silang lihim na hindi ko nalalaman.

18. A lot of people volunteer their time and resources to help those in need.

19. Ang lakas ng ilaw ng kanyang flash light.

20. John and Tom are both avid cyclists, so it's no surprise that they've become close friends - birds of the same feather flock together!

21. Alors que certaines personnes apprécient le jeu comme passe-temps ou forme de divertissement, il peut également conduire à la dépendance et à des problèmes financiers.

22. Bawal maglaro ng bola sa loob ng bahay dahil ito ay nakakasira ng gamit.

23. The acquired assets will improve the company's financial performance.

24. I have been jogging every day for a week.

25. Esta salsa es muy picante, ten cuidado.

26. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

27. Beinte pesos ang isang kilo ng saging.

28. Pinaluto ko ang adobo sa nanay ko.

29. La creatividad es fundamental para el desarrollo de ideas innovadoras.

30. Les sciences de la Terre étudient la composition et les processus de la Terre.

31. Nagtawanan ang mga kaibigan, waring may alam silang lihim na hindi ko nalalaman.

32. My name's Eya. Nice to meet you.

33. Anong oras ho ang dating ng jeep?

34. Los trabajadores agrícolas se encargan de cosechar los campos a mano.

35. Maghilamos ka muna!

36. She has been running a marathon every year for a decade.

37. Marahil ay hindi mo muna dapat gamitin ang pera mo sa pagbili ng bagong gadget.

38. Nagulat ang magkasintahan nang biglang dumating ang pamilya ng lalaki para sa pamamamanhikan.

39. Sa pook na iyon, sa nakaririmarim na pook na iyon, aba ang pagtingin sa kanila.

40. Trump's rhetoric and communication style were often unconventional and garnered both passionate support and strong opposition.

41. Drømme kan være en kilde til trøst og håb i svære tider.

42. En invierno, la ropa de invierno, como los abrigos y las botas, está en alta demanda.

43. Ibinili nya ng maraming diaper ang kanyang anak.

44. Football requires a lot of stamina, with players running and moving for extended periods of time without stopping.

45. Kings may wield absolute or constitutional power depending on their country's system of government.

46. Magandang Gabi!

47. Paboritong laro ng kuya ko ang basketbol.

48. Hindi dapat maapektuhan ng kababawan ng mga tao ang ating mga desisyon sa buhay.

49. Ang mga bata ay nagtatanim ng mga buto upang makita ang proseso ng paglaki ng mga halaman.

50. A los 13 años, Miguel Ángel comenzó su aprendizaje en el taller de Domenico Ghirlandaio.

Recent Searches

choicekuneleukemiafurystonehamdamitsoonsourcesofficebluemovingfatalplatformsvasquesdaigdigpartnerfuturewithoutbilingclientereadwhichservicestechnologiestelevisedrecentmrsprotegidohanapinpalakainiisipkuwartaalasmukhapalayanhistorysalbahehangaringpatulogeksenalumibotforcesagilitysumasayawteachdahilkwenta-kwentapamburaobra-maestranaglalatanglumalangoynananaloerlindanagkwentot-shirtnakakagalakakuwentuhanlibangankahariannakikianamumulotnangyariumagawdisfrutarsinasadyakasintahanberegningerharapanstorypagbigyanre-reviewtagpiangmasaktanmasasabinakabluecleansakophatinggabimaskaranangingilidtransportpakilagaypangambakastilapaliparintindahanininomtengabopolspatongpangako3hrsrecibirmusicianmanipismaingattibigkasakitganitoanongpresyobigyannangangahoyassociationaminutilizarkarapatantuloy-tuloytaingabusiness,nagbasameaningutilizanilinisbusyangsinipangbecomedawsiempreprogramadevelopedbiggestrobotichalljacememorialtotoomalalimmalayadatisumusulatpiratanakakaalamdidinuminagostanda18thenvironmentreleasedbadinginfluenceochandoemphasiscertainevolvedmanagersmallatingaplicaipagtimplabadroquehigitkawili-wilinanghihinamadumakyatnakakatulongpagka-maktolinaaminsinagotulitevnereaksiyonmagpaliwanagkarununganbinibiyayaanliv,araymagkamalipagkalitostrategiessulyapmagpahabalalabasbalahibovaccinesika-12pinapakingganpagiisipmaynilanaiwangunangnagwikangbutasmagsaingsalesangkanmarmainginakyatbabybuenaboholayokocitizenneed,parkingbitiwan00amfree