Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Nabagalan ako sa simula ng pelikula.

2. Sa gitna ng dilim, nagbabaga ang mga uling sa apoy, nagbibigay-liwanag sa paligid.

3. Have you been to the new restaurant in town?

4. The game is played with two teams of five players each.

5. Kanino mo pinaluto ang adobo?

6. Pupunta kami sa Cebu sa Sabado.

7. Reinforcement learning is a type of AI algorithm that learns through trial and error and receives feedback based on its actions.

8. Bagay na bagay sa kanya ang suot na traje de boda.

9. Oo. Tatawagan ka daw niya pag nandyan na siya.

10. El discurso del político está llamando la atención de los votantes.

11. Der er også mange forskellige former for motion, som kan udføres uden nogen speciel udstyr, såsom gåture og trappetrin træning.

12. Gusto ko lang ng kaunting pagkain.

13. Ipaghanda mo si Lina ng Maghanda ka ng damit

14. Pagkatapos ng isang daang metro kumanan ka.

15. "Maghintay ka lang," ani ng guro sa kanyang estudyante.

16. Emphasis can be used to contrast ideas or draw attention to a particular aspect of a topic.

17. It takes strength and courage to offer forgiveness, especially when the hurt is deep.

18. Insider trading and market manipulation are illegal practices that can harm the integrity of the stock market.

19. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

20. Tatanggapin ko po ang anumang kaparusahan.

21. "The more people I meet, the more I love my dog."

22. Nareklamo ko na ho ito pero wala hong sagot.

23. Napilitan silang magtipid ng tubig dahil sa patuloy na tagtuyot.

24. Naabutan niya ito sa bayan.

25. Makikipag-dueto si Maria kay Juan.

26. At malaman ng maaga ang wasto sa kamalian.

27. Sa bawat salaysay ng nakaligtas, maririnig ang kanilang hinagpis sa trahedya.

28. La historia del arte abarca miles de años y se extiende por todo el mundo.

29.

30. Ikaw ang bumitaw! hila-agawan ang ginagawa namin.

31. I love coming up with creative April Fool's jokes to play on my friends and family - it's a great way to bring a little humor into our lives.

32. Ang pag-asa ay nagbibigay ng mga oportunidad sa mga tao upang magtayo ng isang mas magandang mundo.

33. Ang pagiging bulag sa katotohanan ay nagdudulot ng pagkasira ng mga personal na relasyon.

34. Sadyang masarap ang lutong ng tinapay na ito.

35. Sa oras na makaipon ako, bibili ako ng tiket.

36. Hindi pa nga ako nagtatanghalian eh.

37. El uso de drogas es un problema grave en muchas sociedades.

38. Binentahan ni Aling Maria ng prutas si Katie.

39. Les hôpitaux peuvent être des endroits stressants pour les patients et leur famille.

40. Kailangan kong tapusin ang ginagawa ko.

41. Elektroniske apparater kan tilpasses til individuelle behov og præferencer.

42. A couple of pieces of chocolate are enough to satisfy my sweet tooth.

43. The pretty lady in the park was surrounded by admirers.

44. La amistad entre ellos se fortaleció después de pasar por una experiencia difícil.

45.

46. El maíz necesita sol y un suelo rico en nutrientes

47. Ang pagkakaroon ng sapat na kaalaman at impormasyon ay nagpapawi ng mga agam-agam at kawalang-kasiguruhan.

48. Sopas ang ipinabalik ko sa waiter.

49. She has learned to play the guitar.

50. Tesla has expanded its operations globally, with presence in various countries and plans for further expansion.

Recent Searches

napaiyaksoonatinrhythmmonumentopagtiisanchoicepatakboproudmaisusuothunidemocraticupuancharismaticbagyopirataikatlongbeganhinahaplospapalapitnaibibigayritohinagispamagatmasaholbluetuyonagpapaigibparatingnanunuksoprobinsyajerrynakinigi-rechargekabibiltovasquesritwalaksidentemagbabalaposterbigsasagutinnariningprobablementetinitindakaparehaumangatinalisgodtmahiwaganapadpadmakipag-barkadacharitablerewardingnaroonincidenceincludedoktorupworkcandidatelabahinjunjunsinagotlacknapasubsobmakakibosasakaypinalalayasskynagdalaexampletusongsourceslumibotdingdingrelevantcomputere,umilingvisualnapilingstyrermakilalanutrienteskapilingnakikini-kinitaindustriyahubad-baropaosnamtinderaceskawallalimpagkataposisipnagkaroontumawatilskrivestumakboartistaspinagmamasdanmaiingayfull-timemaglakadhinatidmadalingganyankaraokepnilitmakabawipinunitmealdapit-hapontapekongtomorrowconvertingreaksiyoncrushcitizenssumibolkayawaiterpare-parehonagagamitclippaglakimantikabulalasawitnapabuntong-hiningamagpaniwalaviewkinakawitanbibilhincountrieskinabukasant-isawaringhouseholdsgreatmuchaskaarawanbangnagbabasatayolumiwagmumurapokeraayusinninainuunahanlabasnasasakupanproductividadpagluluksastudentstagtuyotlawaobra-maestrahapag-kainantanyagnaiwangkusinerobinibiyayaankamustakumakalansingpusaprincipalestonightnawawalamasaganangmatalikinfusionespagpapakalatnagtrabahoasimconventionalboyetmagkaibahandakisapmatadresserlindaeveningkoreakikorolandtuktokvariousnapaplastikansigurotipnakikitangmapayapakananpopulationpagkainisdiyan