Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Aba oo, yun lang pala, nakakunot-noong sagot ni Kablan.

2. The museum offers a variety of exhibits, from ancient artifacts to contemporary art.

3. Isang tanod ang dumating at sinabing may dalaw si Tony

4. An oscilloscope is a measuring instrument used to visualize and analyze electrical waveforms.

5. Taga-Ochando, New Washington ako.

6. Gusto kong manood ng sine bukas, bagkus magbabasa ako ngayon ng libro.

7. The website's analytics show that the majority of its users are located in North America.

8. Sa pagguhit, mahalaga ang pagpili ng tamang anggulo at perspektiba.

9. Sa facebook ay madami akong kaibigan.

10. Ano ang kulay ng libro ng kaklase mo?

11. Kailan po kayo may oras para sa sarili?

12. Facebook has become an integral part of modern social networking, connecting people, fostering communities, and facilitating communication across the globe.

13. Gaano ka kadalas kumain ng baboy?

14. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

15. All these years, I have been working hard to achieve my dreams.

16. Sa kabila ng kanyang tagumpay, nananatiling humble at grounded si Carlos Yulo.

17. Ang magnanakaw ay nagtago sa isang madilim na eskinita matapos ang kanyang krimen.

18. Consumir una variedad de frutas y verduras es una forma fácil de mantener una dieta saludable.

19. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

20. Tumango lang ako. Wala ako sa mood na magsalita.

21. I am not planning my vacation currently.

22. Nasaan si Trina sa Disyembre?

23. Ano ang ginugunita sa Thanksgiving Day?

24. Sa ilang saglit ang matandang babae ay naglaho at ang lugar na dating kinatitirikan ng kanyang bahay ay naging lawa.

25. Mayroon ding mga kompyuter sa ilang silid-aralan upang matulungan ang mga estudyante sa kanilang mga proyekto.

26. Ipinahamak sya ng kanyang kaibigan.

27. Trump's approach to international alliances, such as NATO, raised questions about the future of global cooperation.

28. Disente naman talaga ang kanilang pamilya.

29. I usually stick to a healthy diet, but once in a blue moon, I'll indulge in some ice cream or chocolate.

30. Las personas pobres a menudo tienen acceso limitado a oportunidades de trabajo y formación.

31. Sa pagguhit, mahalaga ang tamang pagbigay ng shadows at highlights upang makalikha ng dimensyon sa isang drawing.

32. Las plantas con flores se reproducen a través de la polinización, en la que los insectos u otros agentes transportan el polen.

33. I know things are difficult right now, but hang in there - it will get better.

34. Investors with a lower risk tolerance may prefer more conservative investments with lower returns but less risk.

35. Bilang isang guro, mahalaga ang aking kamalayan sa mga pangangailangan ng aking mga mag-aaral upang magtagumpay sila sa kanilang pag-aaral.

36. He drives a car to work.

37. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

38. En resumen, la música es una parte importante de la cultura española y ha sido una forma de expresión y conexión desde tiempos ancestrales

39. Sa ganang iyo, sapat na ba ang ginawa niya upang maitama ang kanyang pagkakamali?

40. Las escuelas ofrecen diferentes planes de estudios, dependiendo del nivel y la especialización.

41. Puwede ba kitang ibili ng inumin?

42. The dog barks at the mailman.

43. The company's CEO announced plans to acquire more assets in the coming years.

44. The stockbroker warned his client about investing in risky assets.

45. Uwi na tayo.. Ayoko na dito sa ospital..

46. Das Gewissen kann uns helfen, die Auswirkungen unserer Handlungen auf die Welt um uns herum zu verstehen.

47. Tumaba sila ng tumaba hanggang sa tuwing maliligo kahit na pa tatlong tao lang sa sapa ay umaapaw agad tubig.

48. Waring may bagyong paparating dahil sa biglang pagdilim ng kalangitan.

49. Les personnes âgées peuvent être bénéfiques pour la société en partageant leur expérience et leur sagesse.

50. Ang bato ay hindi mahuhulog kung walang sisidlan.

Recent Searches

choicefakeibalikmaalogbaulkumarimotemailpanguloforcessumalicadenaphysicalsaringlegislativehanactivitypointprovidedimpitstoplightsamaarmeddebatestrainingstartedprogrammingrepresentativewithoutremotefallmaratingbetaramdambukasapoymalamangawameanspadabogdifferentfanssumalamalabolineallowedbestidosakayinfluencetelevisedblesscleancallhatinghassupilinisinarabateryaamericanathenahimayinwaiteradditionally,diseasesnahantadwakasbahagyanghunihalinglingconvey,cynthiaitinagomahahabamapaibabawdiagnosesdipangkassingulangmustcitizenenfermedades,napakamisteryosotuladposporotigaspunongkahoymagbabakasyonnagkitasocialpresidentialnagmakaawamakikiraanmagnakawspiritualkinamumuhiankapamilyatrinamagkaibapagsumamokaloobangmakakawawanagtatampopakanta-kantangmagkamalidadalawinsiniyasatnag-aagawanpamilyangmakahiramnapabalikwashayaannakatindigmananakawnapakalusogunattendedkatuwaanestablishdinalawpakaincongresseffortsprimerbroadcastmasnapadpadmagkasakitmangahasadgangmahinapambatangmedikalisinuotrektangguloskyldes,napatigiltungkodinakalakalabantamarawfulfillmentkulturlumusobiikutanpagbabantananonoodtelebisyonunidosfranciscomakapalnatapakaninspirationbaclaranlavmonumentoebidensyaitinulostanawtmicapinalambotwondermagta-trabahomatikmantomorrowsalapinaminngipingalmacenarpnilittiyanitonglaybrarimanghulilegacythankmulighederwidelyuntimelykabutihandahanitutolfuenatanggaphomespinyamagdaaniallowingallottedaywanpiecessinapakdietradioknightmamidolyarinternalmatangdancebientodayrole