Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. The doctor measured his blood pressure and diagnosed him with high blood pressure.

2. Si Aling Juana ang tagalaba ng pamilya.

3. Las hierbas aromáticas agregan un delicioso sabor a las comidas.

4. A dedicated student is willing to put in the extra hours of studying to excel academically.

5. I met a beautiful lady on my trip to Paris, and we had a wonderful conversation over coffee.

6. Einstein's ideas challenged long-held assumptions about the nature of space and time.

7. Det er vigtigt at huske, at helte også er mennesker med fejl og mangler.

8. Mahal na mahal kita.. wag mo muna akong iwanan, please.

9. La obra de arte abstracto en la galería tiene una belleza sublime que despierta la imaginación.

10. The task of organizing the event was quite hefty, but we managed to pull it off.

11. Para poder cosechar la uva a tiempo, debemos empezar con la vendimia en septiembre.

12. Hindi dapat nating pabayaan ang ating mga responsibilidad sa buhay, samakatuwid.

13. They may also serve on committees or task forces to delve deeper into specific issues and make informed decisions.

14. Gusto kong maging maligaya ka.

15. La esperanza es una luz que brilla en la oscuridad, guiándonos hacia un futuro mejor. (Hope is a light that shines in the darkness, guiding us towards a better future.)

16. Tanging ina lang at kapatid niya ang kanyang kasama

17. Hindi natin dapat husgahan ang mga tao base sa kanilang kababawan dahil maaaring mayroon silang malalim na dahilan.

18. Gusto ko na po mamanhikan bukas.

19. Las heridas en las extremidades pueden requerir de vendajes compresivos para detener el sangrado.

20. Da Vinci murió en Francia en el año 1519.

21. Está claro que debemos tomar una decisión pronto.

22. Nakita kita sa isang magasin.

23. Mabilis na lumipad ang paniki palabas ng kweba.

24. Iniintay ka ata nila.

25. Makakasahod na rin ako, sabi niya sa sarili.

26. They have already finished their dinner.

27. The DNA evidence led to the arrest of the culprit in the murder case.

28. The Constitution divides the national government into three branches: the legislative, executive, and judicial branches

29. The company launched a series of new products, targeting different customer segments.

30. Awitan mo ang bata para makatulog siya.

31. He has improved his English skills.

32. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

33. Det har ændret måden, vi interagerer med hinanden og øget vores evne til at dele og få adgang til information

34. Ang trahedyang naganap sa kanilang komunidad ay nagdulot ng pangmatagalang lungkot sa kanilang mga puso.

35. Eine hohe Inflation kann zu einem Anstieg der Zinsen führen, um den Anstieg der Preise auszugleichen.

36. Dapat magkaroon ng patas na pagtrato sa lahat ng sektor ng lipunan, kabilang ang anak-pawis.

37. Landet er et af de førende lande i verden inden for økologisk landbrug, og det er også et af de førende lande inden for vedvarende energi

38. Malaki at mabilis ang eroplano.

39. Ang daming labahin ni Maria.

40. Napadami ang inom ni Berto kaya't ito ay nalasing.

41. Napatingin ako sa kanya, Bakit naman?

42. John Tyler, the tenth president of the United States, served from 1841 to 1845 and was the first president to take office due to the death of a sitting president.

43. Vi kan alle være helte i vores eget liv og gøre en forskel for andre.

44. Lumapit siya sa akin at sumandal sa may sink.

45. Noong una ho akong magbakasyon dito.

46. Gusto kong malaman mo na may ganitong pakiramdam ako, kaya sana pwede ba kita ligawan?

47. Kailangan nating magkaroon ng lakas ng loob upang tuparin ang ating mga pangarap.

48. Ang pagtulog ng maayos ay nagpapabuti sa emosyonal na kalusugan at nagbibigay ng katahimikan at kapanatagan sa puso't isipan.

49. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

50. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

Recent Searches

choicecrossnagpipilittotoohalikansamfundtherapeuticsmungkahibawalnasamasayahinsumugodnapatulalatsinanapilibinulongsedentarymagsabisasabihinnakangisitrentaotsopocachumochosnagniningningmatuklasanmay-bahaymadurosinisiraipihitaparadortaga-suportaumiinitnaawalumakimegethalamanangancestralesnalulungkotdahan-dahanmagpapagupitdidinginfectiousclassesmaglalaromatagpuankatagangalamformasipapahingaunti-untingloob-loobtienenemnerdalawaspendingnumerosaskapagrestawranbaduyneversugathome1928hayaannasulyapanmagpahabapagkatakotnaiinitanmalamigmagulangagatanongartistasadditionkidkirandatihabitmagbigaymagbungainalismenuritwalcommunicationsmedikaltessnampagkokakkumitabellospitalsundhedspleje,matayognakakuhamaluwanghinipan-hipanbanaltshirtkulotroughhangaringbukaspwestoanak-mahirapchinesekainitanfinalized,unangmakakakaugnayannakakapagtakamagdapaladnilinisevilnasunogniyapapelutak-biyanatatawadiningsakanagagalitsummitnapabayaanlalapitnakakalasinglagingnagpalipatipinagbabawalrevolutioneretlakassatisfactionhiwagaloansdakilangunoumagawtanghaliannanakawannaminrecentinteligenteskindlesalbahemaagangtrasciendebyggetna-curiouspanunuksoeachambagtrajesilid-aralanrabonatitigilstatingmabangomaabotpunoobviouskarunungannaalalamassachusettstinatawagniyotienesanangngipiniphonediaperkalakiindividualsanjopabigatsinumangbumabababentanglinggoapelyidosigurohistoriatengafollowing,giverbunutanjosephsipapedrorenaianakaliliyongkinuhatindahaneconomysambitparintenidokaininspindlenagawang