Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Nanlalamig, nanginginig na ako.

2. The stock market can be influenced by global events and news that impact multiple sectors and industries.

3. Instagram also offers the option to send direct messages to other users, allowing for private conversations.

4. Foreclosed properties can be found in many areas, including urban, suburban, and rural locations.

5. Pakibigay ng malakas na palakpak ang lahat para sa ating mga guro.

6. The rise of social media has further expanded the reach of the internet, allowing people to connect with friends and family, as well as share their thoughts and experiences with a global audience

7.

8. Higupin ng halaman ang tubig mula sa lupa.

9. It’s risky to eat raw seafood if it’s not prepared properly.

10. Nakakuha ako ng sagot sa brainly.

11. Sa pagguhit, mahalaga ang tamang pagkakabalangkas ng mga elemento.

12. Sa loob ng isang saglit, hindi niya maulit na salatin ang biyak na pisngi.

13. Bakit ayaw mong kumain ng saging?

14. At sa sobrang gulat di ko napansin.

15. If you want to secure a good seat at the concert, you have to arrive early - the early bird gets the worm.

16. Tila may lihim siyang itinatago sa atin.

17. In the 1970s, the answering machine was invented, it became a popular way for people to screen calls and leave messages

18. Taking unapproved medication can be risky to your health.

19. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

20. Iwanan kaya nila ang kanilang maruming bayan?

21. The company’s momentum slowed down due to a decrease in sales.

22. They offer rewards and cashback programs for using their credit card.

23. Limitations can be overcome through perseverance, determination, and resourcefulness.

24. Ang maalikabok at baku-bakong lansangan ng Nueva Ecija ay kanyang dinaanan.

25. Ang ganda ng bagong laptop ni Maria.

26. Las vacaciones son una oportunidad perfecta para desconectar del trabajo.

27. Dahil alam niyang galit na ang kanyang ina ay di na umimik si Pinang.

28. Sira ka talaga.. matulog ka na.

29. Ipinagbabawal ang marahas na pag-uusap o pagkilos sa paaralan.

30. His speech emphasized the importance of being charitable in thought and action.

31. Nang sumapit ang ika-12 ng hating gabi, nagpalit ng anyo ang kakaibang pusa.

32. In recent years, the telephone has undergone a major transformation with the rise of mobile phones

33. If you think I'm the one who broke the vase, you're barking up the wrong tree.

34. Mahirap magluto ng pulotgata dahil kailangan ng tamang timpla.

35. Hinding-hindi napo siya uulit.

36. Sa ganang iyo, tama bang ipagbawal ang paggamit ng plastik sa mga pamilihan?

37. Sambit ng prinsipe habang hinahaplos ang pisngi ng iniirog.

38. Muchas ciudades tienen museos de arte que exhiben obras de artistas locales e internacionales.

39. Aku benar-benar sayang dengan hewan peliharaanku. (I really love my pets.)

40. Si Rizal ay isang maalam na mag-aaral na nag-aral sa Unibersidad ng Santo Tomas, Unibersidad ng Madrid, at Unibersidad ng Heidelberg.

41. Patients are usually admitted to a hospital through the emergency department or a physician's referral.

42. Nosotros disfrutamos de comidas tradicionales como el pavo en Acción de Gracias durante las vacaciones.

43. Nangumbida ako ng maraming tao kasabay ng biling 'wag kalimutan ang regalo at pagbati ng �Happy Birthday,Rebo!�

44. To break the ice with a shy child, I might offer them a compliment or ask them about their favorite hobbies.

45. Algunos músicos famosos incluyen a Mozart, Beethoven y Michael Jackson.

46. Musk has been described as a visionary and a disruptor in the business world.

47. Si Carlos Yulo ay kilala bilang isa sa pinakamahuhusay na gymnast sa buong mundo.

48. Ang problema niya nga lang ay sadyang malayo ang paaralan sa palasyo kaya kinausap niya si Helena tungkol sa bagay na iyon.

49. Pinarusahan ang empleyado na na-suway sa patakaran ng kumpanya.

50. Ikaw ang dumukot ng pitaka ko, ano? Huwag kang magkakaila!

Recent Searches

aalisbokchoiceitonapailalimstaripagamotboksingnitonglatestschoolswatchingklimanuonnagbungacryptocurrencykabibicardmaitimpshalepressbarhalamanaddressagilityfinishedfuncionesflooractinginalismabutinggamesumaladeleagosmamulotelectiontandasciencepedeabstainingsumalilegislativecoachingcoaching:audio-visuallydesdemamisuelo1973reserveduminomseenflyroquethoughtsprovidedbabadoonbehalfcleanworkdayformabringcescandidatedividesfatalvisonemapapadulainternetcallintodidingredlayout,lockdownresultiosbornprogressmethodsnapilingaddingusingdevelopgitaraformatcertainstartedinformedvisualneedsautomaticcompleteiginitgitmonitortypeshighestrepresenteddraft,masterdedicationclassmatespreadeveryformnariningfacemotioninternatradisyonthroatapoymagsugalpagkakilalapatpatpangingimiiatfgabingmundokabiyaknapakahusayshinessino-sinomasayang-masayanagsagawahalipanitobaglansanganpaglisanniyaritwalbulaklaksumasayawproducererpagbabantafederalenergihidingnalagpasanlokohintalaganghinugottoycarbonbulalasbuwayapoliticssumigawchoimediaulamwalngmaarispecialtrafficlumalangoyelectedikinatatakotnagtutulungannagtatakbonakaramdamnanghahapdikomunikasyonkawili-wilipagluluksakumembut-kembotnakaliliyongnapaluhapaghalakhakmagkaibanagpaiyakkapangyarihangnagtrabahomagasawangcarsnapapatungokinagagalaknamulatpagpasensyahanpinagpatuloyikinasasabiknagmungkahimakauuwipangungutyanagre-reviewnagtagisanpagsasalitapagkalitoinasikasonageespadahanpaglalabadapumapaligidbiologimensajes