Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Ang takip-silim ay isang panahon kung saan maaari mong maappreciate ang ganda ng kalikasan at ng mga gusali.

2. Datapwat mali sila ng akala, sapagkat ang anak ay hindi nagbago.

3. Pardon me, but I don't think we've been introduced. May I know your name?

4. Doa juga bisa dianggap sebagai bentuk ungkapan syukur atas nikmat dan karunia yang diberikan Tuhan.

5. Ibinigay niya ang kanyang pag-ibig at suporta sa gitna ng mga pagsubok.

6. The teacher explains the lesson clearly.

7. Babalik ka pa ba? nanginginig na yung boses niya

8. Sakay na! Saan ka pa pupunta?!!

9. Los héroes son modelos a seguir para las generaciones futuras.

10. Dahil sa pagtatapos ng isang mahabang relasyon, siya ay puno ng lungkot at panghihinayang.

11. Good things come to those who wait.

12. En resumen, el teléfono es un dispositivo electrónico que permite la comunicación a distancia mediante el uso de señales de sonido

13. Cuando no sé qué hacer, simplemente confío en que "que sera, sera."

14. Marahil ay dapat kang mag-isip-isip muna bago magdesisyon sa mga bagay-bagay.

15. Araw- araw nangangahoy si Mang Kandoy sa kagubatan para gawing uling.

16. El nacimiento de un hijo trae consigo responsabilidades y la necesidad de cuidado y protección.

17. Un powerbank completamente cargado puede ser una fuente de energía de respaldo en caso de emergencia.

18. Si Teacher Jena ay napakaganda.

19. Mag-uusap kami sa makalawa ng tanghali.

20. She loved to travel, and therefore spent most of her savings on trips.

21. No tengo apetito. (I have no appetite.)

22. The United States has been involved in many international conflicts, including World War I and World War II.

23. A lot of laughter and joy filled the room during the family reunion.

24. Simula noon ang batang si Amba ay naging unang gagamba.

25. Cancer can have physical symptoms, such as pain, fatigue, and weight loss, as well as emotional symptoms, such as anxiety and depression.

26. Disse inkluderer terapi, rådgivning og støttegrupper.

27. The students are studying for their exams.

28. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

29. Naglalakad ako sa kalsada nang bigla akong napagod sa hatinggabi.

30. I hate it when people beat around the bush instead of just getting to the point.

31. Hindi ko kayang magpanggap dahil ayokong maging isang taong nagpaplastikan.

32. Sa takip-silim, nakikita mo ang kagandahan ng mga kalsada dahil sa mga ilaw na nagbibigay ng magandang siluet sa mga tao.

33. Un powerbank es un dispositivo portátil que permite cargar dispositivos electrónicos.

34. Tinanggap niya ang lahat ng ito at marami pang iba sa kaniyang kaarawan.

35. Kebahagiaan tidak selalu tergantung pada materi atau kekayaan, tetapi pada keadaan batin dan kepuasan diri.

36. Mahirap ang walang hanapbuhay.

37. The construction of the building required a hefty investment, but it was worth it in the end.

38. Ang pagbabago ng pananaw at pag-iisip ay maaaring magdulot ng pagbabago sa pangamba.

39. Nabasa mo ba ang email ko sayo?

40. Birthday mo. huh? Pano niya nalaman birthday ko?

41. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

42. Ano ang naging sakit ni Tita Beth?

43. Ano ang pangalan ng doktor mo?

44. Naging hobby ko na ang paglalaro ng mobile games kaya nahuhumaling ako.

45. Min erfaring inden for dette område har været meget givende.

46. Kumikinig ang kanyang katawan.

47. Keep practicing and hang in there - you'll get better at it.

48. Ano yung dapat mong gagawin mo sakin kanina?

49. Naglaba na ako kahapon.

50. She is not playing the guitar this afternoon.

Recent Searches

choicestrategyjobganoonpopulationdeterminasyonlamesawordsitinatagbasketballugatkandidatoikinuwentosukatinfistsikinagagalaksinikapejecutarnaghihinagpishinatidpinaulananmillionssanacriticskinumutanenduringbotantehuliahaspublicationcandidatesnamumukod-tangibukaskonsultasyonmapapansinkumitabuwenasnapakatagalmagtataasdiagnosticnagsimulajuicecreatedpagpalitelijepagdidilimutosspataong-bayanhinugotpeksmannaghandaicemapagbigayneartressayawanpumansinlabaniyonpalasyopagkabuhaysangastarted:pusalabanannagtitiislibertykaragatan,samahandanskebinibiyayaanapotabing-dagatbusknowledgeconectanpalagiblusafeardagatpang-araw-arawpinakidalaitimimprovementrequireskaguluhannatakotsemillasnaawaminamasdanagam-agamkalikasanumalismagandaenfermedadesisusuotrodonanoblenabigkasmagkaibanamalagitambayanrhythmhealthhotdogmasaholmagkaharapnagbuntongpalibhasanalalabipigingbiyahevitaminsjunioganangmarangyangpumilinag-alalakombinationdetallanreleasedfatkangitangustokaibapondopublishingmusmoskamingsocialrolandsasabihintuluyangkoreawarimabihisanconcernsomelettemassespaniwalaanpagtungoambagkontingmahabangmahinogcivilizationtumalonaga-agacreditpublicitykotsekwenta-kwentamuchasnakakarinignangangambangtatawagkilalapangitexpectationsmangingibigassociationhaceruniversetydelsernagrereklamosamang-paladorasnapabayaansoundmakisuyoina-absorvecomeperonagbigayjunjunconsumeernanbabayaranhierbaspilanatutulogsubalitniyaaabsenttumakasnamataynaglahoinuminpagtatanimkabarkadainteligentesipagbilinalugiprincipalesartefundriseparekasinggandatag-araw