Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. Gusto kong manood ng mga pambatang palabas.

3. Los teléfonos móviles, también conocidos como celulares, son probablemente los tipos de teléfonos más comunes en la actualidad

4. Narito ang pagkain mo.

5. Ang punong-kahoy ay nagbibigay ng sapat na lilim para sa mga nilalang na nabubuhay sa ilalim nito.

6. Gracias por iluminar mi vida con tu presencia.

7. Electric cars are part of a larger movement toward sustainable transportation, which includes public transportation, biking, and walking, to reduce the environmental impacts of transportation.

8. Magandang umaga po, Ginang Cruz.

9. While it has brought many benefits, it is important to consider the impact it has on society and to find ways

10. Agad naman na ngpunta si Aling Edna sa bahay nila na daladala ang parte nila sa napaghatian na gulay at bigas.

11. Nagpakita sa Datu ang Dakilang Bathala at ipinaalam sa ama na ang kanyang anak ay mabubuhay ng labing-siyam na taon lamang.

12. Naglalaway ang mga manonood habang pinapakita sa TV ang masarap na pagkain.

13. Wag mo ng pag-isipan, dapat pumunta ko.

14. Menghabiskan waktu di alam dan menjalani gaya hidup yang sehat dapat meningkatkan perasaan kebahagiaan.

15. ¿Dónde está el baño?

16. She's always creating drama over nothing - it's just a storm in a teacup.

17. Sa itaas ng burol, tanaw na tanaw ng lahat na nagdudumaling lumabas si Kablan sa tindahan.

18. Nakapag-simula ako ng halinghing exercise nang hindi inaasahan na makakatulong ito sa aking anxiety.

19. Sa mga lugar na may tag-ulan, kadalasang mas madalas magkasakit ang mga tao dahil sa mas mabilis na pagkalat ng mga sakit sa panahon ng malakas na ulan.

20. Wer im Glashaus sitzt, sollte nicht mit Steinen werfen.

21. Sa kasal, ang dalawang taong nagmamahalan ay nagbibigay ng kanilang matapat na pangako sa isa't isa.

22. Exercise can be tough, but remember: no pain, no gain.

23. Sa bawat pagkakataon na binibigyan tayo ng pagkakataon, dapat nating gamitin ito nang wasto, samakatuwid.

24. The phone rang late at night, and therefore she was hesitant to answer it.

25. Hindi dapat magpabaya sa pag-aalaga ng kalusugan sa pamamagitan ng regular na ehersisyo at malusog na pagkain.

26. Selvstændige medarbejdere arbejder ofte på egen hånd.

27. kami kumikilos mula sa kinatatayuan namin.

28. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

29. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

30. For nogle kan fødslen være en åbenbaring om styrken og potentialet i deres egen krop.

31. Nasa Massachusetts ang Stoneham.

32. Television has a rich history, and its impact on society is far-reaching and complex

33. Hindi malaman kung saan nagsuot.

34. Salatin mo ang upuan upang matiyak na tuyo ito bago ka umupo.

35. If you spill the beans, I promise I won't be mad.

36. Cryptocurrency exchanges allow users to buy, sell, and trade various cryptocurrencies.

37. Da Vinci fue un artista renacentista muy importante.

38. Working in a supportive and positive environment can improve job satisfaction.

39. El atardecer en el mar es un momento sublime que muchos aprecian.

40. Pakibigay ng malinaw na paliwanag sa tanong upang mas madali itong maunawaan.

41. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

42. La seguridad y el bienestar de los agricultores y sus familias son importantes para garantizar un futuro sostenible para la agricultura.

43. Gagawa ako ng tsaa pagkatapos kong kumain.

44. Gracias por tu amabilidad y generosidad.

45. Este año espero cosechar una buena cantidad de tomates de mi huerto.

46. Ang pagtitiyaga sa pagbabayad ng utang ay magdudulot ng kapanatagan sa buhay at magpapalakas ng financial stability.

47. Børn har brug for at lære om kulturelle forskelle og respekt for mangfoldighed.

48. The hiking trail offers absolutely breathtaking views of the mountains.

49. In 2014, LeBron returned to the Cleveland Cavaliers and delivered the franchise's first-ever NBA championship in 2016, leading them to overcome a 3-1 deficit in the Finals against the Golden State Warriors.

50. I sent my friend a bouquet of flowers and a card that said "happy birthday."

Recent Searches

additionperlachoicepicsyelolasingeroklimaspecialsystematiskexamartsmesangbumahadawsellsinunodgumuhitkruspartnerochandoratewealthpublishingpaslitbelievedsarilingditocoinbasetsaa18thgitanasreadcharitableallowscorrectingrelevantlightsschoolfascinatingsharedaratingfataltuluyangipinatawagnananaghilinakagalawernantulisanlamangiyankinalakihanpananglawnaglulusaksasabihinhimigtumalonincomepasasalamatumaalisfacultysetstuvobinibinimanunulatkayanaghihinagpisbarincreasedlilipadnowgayakaraokematustusantayojanmatapobrengstarstataasarghstrategyfinditsurasumuotbiromapahamakkumalantogpagdukwangtumirapambatangexportnabigyantobaccofriendnagpipiknikmabiropinagmamasdannakukuhanapakokatandaanhesukristocasasasakaysinoparingsamantalangnatatanawpagsidlanartehinagisekonomiyauntimelypinagkasundosumasakitbroadcastperangtodaypanguloarmednicoclocklutuinpinagsikapanpinagsanglaandadalawintatawagnagkitasarapbalitahampaslupamakikitulogkatuwaanmensahemakasalanangjuanamusicnapatigilnagpakunotpagtataasnatuyokalarotanongligaligeleksyonchooselegacysusulitnochebroadcastsmalihisfilmsbaduyobservererpinakamahalagangnakapasaumangatmakapallotnangsumalakabibibitawanstudiedpaboritongnakasakaymangangahoyutosmahiwaganghayopkakaininkatipunankamalayannakitangmahuhulimagtatanimisinulatpinagmamalakiaumentarmusicianswidelyeclipxeipinasyangpierniligawanconcernbilingnagagandahansalamangkeromakasilongsasayawinsalenagtitinginanmakakakainliv,ibahagikayonangapatdanmagtakaibinilinagcurvenagdiretso