Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Bakit siya pa yung kelangan mong pahirapan?

2. Then you show your little light

3. The United States has a complex and diverse food culture, with regional specialties and international cuisine.

4. Our relationship is going strong, and so far so good.

5. Ang kalayaan ay nagbibigay sa atin ng lakas at kahandaan na labanan ang mga paglabag sa ating mga karapatan.

6. Ese vestido rojo te está llamando la atención.

7. Gusto ko na po mamanhikan bukas.

8. In this industry, singers who can't write their own songs are a dime a dozen.

9. Les enseignants doivent respecter les normes de sécurité en vigueur dans les écoles pour protéger les élèves.

10. Acara keagamaan, seperti perayaan Idul Fitri, Natal, Nyepi, dan Waisak, dihormati dan dirayakan secara luas di Indonesia.

11. Di ka galit? malambing na sabi ko.

12. Bumili si Ana ng regalo para sa asawa.

13. Der frühe Vogel fängt den Wurm.

14. Miguel Ángel Buonarroti fue un artista italiano del Renacimiento.

15. Walang password ang wifi ng kapit-bahay.

16. Not only that; but as the population of the world increases, the need for energy will also increase

17. Sa karagatan ay masusumpungan ang magagandang koral at mga isda.

18. Anong pagkain ang inorder mo?

19. Maraming bayani ang nagawa ng mga bagay na imposible sa panahon ng kanilang panahon.

20. Bawal magpakalat ng mga paninira sa kapwa dahil ito ay labag sa moralidad at etika.

21. Les enseignants peuvent adapter leur enseignement en fonction des besoins et des niveaux de compréhension des élèves.

22. Las hojas de mi planta de tomate se ven amarillentas y enfermas.

23. Many people work to earn money to support themselves and their families.

24. Sweetness is an important factor in the culinary arts and food industry.

25. Ano ho ang nararamdaman niyo?

26. Seguir nuestra conciencia puede requerir coraje y valentía.

27. She's always creating drama over nothing - it's just a storm in a teacup.

28. Kailangan ko ng Internet connection.

29. Nakakain ka ba ng mga pagkaing Pilipino?

30. Nationalism is a complex and multifaceted phenomenon that continues to shape the modern world.

31. Nakikita ko ang halinghing ng mga bata habang naglalaro sa parke.

32. Mens nogle mennesker kan tjene penge ved at gamble, er det en risikabel investering og kan ikke betragtes som en pålidelig indkomstkilde.

33. Sa bata nakatingin ang pulis na wari'y nag-iisip ng dapat gawin.

34. La arquitectura es una forma de arte que se centra en el diseño y construcción de edificios.

35. Dumilat siya saka tumingin saken.

36. Ang droga ay hindi nagbibigay ng solusyon, kundi dagdag na problema pa.

37. He does not waste food.

38. Mahina ang internet sa inyong lugar? Kung gayon, baka mas mabuting gumamit ng mobile data.

39. I always wake up early to study because I know the early bird gets the worm.

40. Los héroes son capaces de tomar decisiones difíciles y hacer sacrificios personales en beneficio de los demás.

41. Kung sino ang maagap, siya ang magandang kinabukasan.

42. Bigyan mo naman siya ng pagkain.

43. Sino-sino ang mga kakuwentuhan mo sa klase?

44. Hindi ko maaaring magpasiya nang mabilisan dahil sa aking mga agam-agam na mayroong magiging masamang epekto.

45. Foreclosed properties may be in need of major repairs or renovations, which can be expensive and time-consuming.

46.

47. Nang maglalabing anim na taon na si Rabona ay may nakita siyang isang pusa sa kagubatan.

48. En invierno, se puede disfrutar de hermosos paisajes cubiertos de nieve.

49. El cuaderno de Leonardo da Vinci contiene muchos dibujos y anotaciones sobre sus inventos.

50. Today, Amazon is one of the world's largest online retailers.

Recent Searches

choicecornersnagkwentopagsalakayloobtumabigulangpasyamatangtumigillaganaptahananfreelancertablenakitangbeingsinisipanghihiyangaraw-badingmahahabalutuinikinamataytugonlagiwithoutgloriahinabolbalancesmakekangkongmedya-agwakadalagahangmagtatampodinanasbitbitsettingstyrerbinanggaleukemianapagtantomemoryconclusionsequesurepadabogprogresslamesastartedmagbabalatatawagumigibkumbinsihinhalipissueskagalakanbutikiindustriyapagbatilaki-lakihumabiamendmentsbinatimag-asawadekorasyondropshipping,namulaklakinterestscosechar,youngtinayhagdananbibisitababasahinkinalilibinganalapaapdurianpilitnobelamagta-trabahonapilikulangtiniklingumigtadnapakamanuksopakibigyansadyangnetopinagmamasdanpakinabangankitangipinapamagatperogoalvaccineshayopbotoonlineattacktandacriticspeoplepahahanapmagpahabakabarkadamahinahongmedikalmangahaspshbahay-bahayitemssaan-saanbukodultimatelykunwakumidlatutusanlalakadinataketulogideatooldesisyonanmaabutanpistatoyslever,pamilihankalaronapasubsobsnobkayongnakapikitsulyappanitikan,ibilipaghugosmemonapakahusayjackycapacidadespaguutoscarriedakinhinilatiketrelevantsakopyunknow-howwaaaeverybabaetenganaiyak3hrsmasiyadobrancher,giitradyokinissbabaeroexcitedbagaymaraminangyaridecisionsairconpabigatmatatandajejusetyembrenageespadahannetflixpanggatonglawsdiyanpeacevoresrevolutionizedyarisonidotiyakancoalparanginantaygabingalamidchoigoshcandidatemusicalkikomalampasanmagpapabakunaserdepartmentmovie