Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. El nacimiento de un bebé trae consigo la alegría de ver crecer y desarrollarse a un ser humano.

2. Sa aksidente sa pagpapalipad ng eroplano, maraming pasahero ang namatay.

3. Hendes hår er som silke. (Her hair is like silk.)

4. Además, el teléfono ha sido una herramienta valiosa en la venta telefónica y en la realización de encuestas

5. Emphasis can also be used to create a sense of urgency or importance.

6. There are so many coffee shops in this city, they're a dime a dozen.

7. Las hierbas deshidratadas se pueden almacenar por más tiempo sin perder su sabor.

8. Sa kalawanging medya-agwa niyon ay nakasilong ang iba pang agwador.

9. Online surveys or data entry: You can earn money by completing online surveys or doing data entry work

10. Akin na kamay mo.

11. Mas romantic ang atmosphere sa dapit-hapon.

12. Min erfaring har lært mig, at tålmodighed er en dyd.

13. Sayang, jangan khawatir, aku selalu di sini untukmu. (Don't worry, dear, I'm always here for you.)

14. I have a tradition of taking a photo every year on my birthday to document how I've changed over time.

15.

16. Det har også skabt nye muligheder for erhvervslivet og ændret måden, vi arbejder og producerer ting

17. As technology continues to advance, it is important to consider the impact it has on society and to find ways to mitigate any negative effects while maximizing its benefits

18. Uwi na tayo.. Ayoko na dito sa ospital..

19. Utak biya ang tawag sa mahina ang pag iisip

20. Martin Van Buren, the eighth president of the United States, served from 1837 to 1841 and was the first president to be born a U.S. citizen.

21. Pinuri ni Pangulong Rodrigo Duterte si Carlos Yulo matapos ang kanyang tagumpay sa gymnastics.

22. Los powerbanks vienen en diferentes capacidades, que determinan cuántas cargas pueden proporcionar.

23. Eksport af elektronik og computere fra Danmark er en vigtig del af landets teknologisektor.

24. Pinakamatunog ang tawa ni Ogor.

25. Tumutulo ang laway ng mga tao sa paligid dahil sa amoy ng masarap na BBQ.

26. Ang paggamit ng droga ay maaaring magdulot ng pagkakasala, tulad ng paglabag sa batas at pagiging sangkot sa mga krimen.

27. Mas malaki ang huli, mas marami rin ang panindang maipapautang sa iyo ng ngingisi-ngising negosyante.

28. Pasensya naman, anak rubber shoes ako eh.

29. The city is home to iconic landmarks such as the Hollywood Sign and the Walk of Fame.

30. Dahil sa sipag at determinasyon, nakamit ni Michael ang tagumpay.

31. Mahalaga rin ang pagkakaroon ng malawak na kaalaman at kakayahan sa pagpapasya upang malutas ang mga palaisipan sa buhay.

32. El nacimiento puede ser un momento de reflexión y celebración, y puede marcar el comienzo de una nueva etapa en la vida de la familia.

33. Electric cars may have a higher upfront cost than gasoline-powered cars, but lower operating and maintenance costs can make up for it over time.

34. Les soins de santé de qualité sont un droit fondamental de chaque individu.

35. Ang mabangong lotion ay nagbibigay ng pag-aalaga sa balat at magandang amoy.

36. Simula noon ang batang si Amba ay naging unang gagamba.

37. He was a pioneer in martial arts and fitness and his teachings are still relevant today

38. Nakatira si Nerissa sa Long Island.

39. Yari sa kahoy ang sahig ng bahay ko.

40. The President is also the commander-in-chief of the armed forces and has the power to veto or sign legislation

41. Herzlichen Glückwunsch! - Congratulations!

42. H-hindi na sabi eh! inis na sabi nya.

43. Sa pagdating ng suporta ng aking mga kaibigan, ang aking pag-aalala ay napawi.

44. The scientific method involves forming hypotheses and testing them through experiments.

45. Hinde ko alam kung bakit.

46. El invierno es la estación más fría del año.

47. Agama menjadi salah satu faktor yang menguatkan identitas nasional Indonesia dan menjaga kesatuan dalam ker

48. Kinuha ko yung CP niya sa bedside table.

49. I am absolutely committed to making a positive change in my life.

50. I have started a new hobby.

Recent Searches

choicewithoutbipolartangekstasainitinabutanjolibeehojascolorreguleringteknologihagdanaccederfatalexpectationsnaglabanannagdarasalmaaariloloschoolsnakayukonatayonapakamisteryosoganangkaloobanghuertobangkonahigitansweethimayinawardanongdalawanagugutommasoksupportmaglalarorektanggulomulighederbeyondmakahiramnagsisigawcarmentilaumilingyelonakakasamafionamapapamatikmansalbaheredigeringmaitimcompletamentenahantadlumitawdecreaseikawalongpatulogmarianbopolshubad-barojunionakakainfureksport,bagongmemorialmarilouswimmingvelstandarghnakainpakilagaynaggalanatuwatripkasintahannangampanyamaisusingrelevantsourcesnatakotrebolusyonnilinisnaulinigankonsultasyondekorasyonsingaporeindiasenateseekaudiencenakatunghaypinipisiltamadpwedesumigawratelunesbalinganmangangalakalgalingmakakamaghahatidmonsignorkalagayanmunakinainydelserauthorpdarequirejosephproducirsizenamataytirangcarscompanypupuntapupuntahanpanunuksomasayangvalleybumahavistrenatohitamusicianultimatelylockedmaipantawid-gutomnaliligoumiwasbigyansyanakabiladbiroself-defensepossiblesubalitipapaputolterminosinaganitonaiinitankanikanilangarturopatongimagesfinishedmaya-mayaemocionesbagfactoreslegendsfittvsmaputi1920skapeeffectpulang-pulanagpuntareplacedmesanganaypinaghalomatangumpaypinakamagalingbwahahahahahailihimwownagwelgaumakyatkuwadernosisentacurtainschadkingpagpanhikpeternalulungkotsharingwednesdaymariailoiloiguhitlandelumiitnakakabangonnatandaanpaumanhinbeinginferioresnananaginipcocktail