Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Antioxidant-rich foods, such as berries and leafy greens, can help prevent chronic diseases.

2. The birds are chirping outside.

3. LeBron James is a dominant force in the NBA and has won multiple championships.

4. Dapat tayong magpasya ayon sa tamang paninindigan at prinsipyo, samakatuwid.

5. Tumango lang ako at ngumiwi, Oo eh, hindi kasi ako sanay.

6. Hindi lahat ng kaibigan ay laging nandyan.

7. Sa gitna ng bukid, natatanaw ko ang mga kalabaw na umaararo sa lupang sakahan.

8. El Día de San Valentín es una oportunidad para demostrar el amor que sentimos por nuestras parejas.

9. Nagpapantal ka pag nakainom remember?

10. Foreclosed properties may be sold in as-is condition, which means the buyer may have to make repairs or renovations.

11. Aksidente niyang nasira ang kanyang cellphone dahil nahulog ito sa banyo.

12. Pinatawad din naman ni Ana ang mga ito.

13. Pagkatapos kong ipagbili ito, bibili ako ng pagkain natin.

14. There?s a world out there that we should see

15. My friends surprised me with a birthday cake at midnight.

16. Matanda na ang kanyang mga magulang at gumagamit na ang mga ito ng diaper.

17. Les employeurs offrent souvent des avantages sociaux tels que l'assurance maladie et les congés payés.

18. The United States has a history of social and political movements, including the Civil Rights Movement and the Women's Rights Movement.

19. Hindi dapat magbigay ng halaga sa mga kababawang bagay tulad ng kasikatan o kasikatan ng mga gamit.

20. Merry Christmas po sa inyong lahat.

21. Ang poot ang nagpapagana sa aking determinasyon na magtagumpay at patunayan ang aking sarili.

22. She is recognized for her iconic high ponytail hairstyle, which has become a signature look.

23. Nanginginig ito sa sobrang takot.

24. Les enseignants doivent planifier leurs cours en fonction des objectifs d'apprentissage.

25. Tumayo tayo para awitin ang Pambansang Awit.

26. Ang matanda ay malilimutin na kaya’t kailangan niya ng alalay sa pag-alala ng mga bagay.

27. Ultimately, the concept of God is deeply personal and subjective, with each person's beliefs and experiences shaping their understanding of the divine.

28. Drinking enough water is essential for healthy eating.

29. La belleza natural de la cascada es sublime, con su agua cristalina y sonidos relajantes.

30. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

31. John Quincy Adams, the sixth president of the United States, served from 1825 to 1829 and was the son of the second president, John Adams.

32. Masarap maligo sa swimming pool.

33. Nous avons décidé de nous marier cet été.

34. Protecting the environment involves preserving natural resources and reducing waste.

35. As AI algorithms continue to develop, they have the potential to revolutionize many aspects of society and impact the way we live and work.

36. Itinaas niya ang tirante ng kamiseta.

37. Nakarating ako ng 4th floor at ako pa rin ang pinag uusapan.

38. Napagod si Clara sa bakasyon niya.

39. Many people go to Boracay in the summer.

40. Musk was born in South Africa and later became a citizen of the United States and Canada.

41. Maaari mo ng bitawan ang girlfriend ko, alam mo yun?

42. Ang buhawi ay isang malakas at mapaminsalang bagyo na karaniwang nagdudulot ng malakas na hangin, pag-ulan, at pagbaha.

43. Sang-ayon ako sa opinyon mo tungkol sa pagsasama ng magkaibang relihiyon.

44. May nanganganib na mawalan ng trabaho dahil sa aksidente na nangyari sa paggawa ng proyekto.

45. Bumisita kami sa museo at kinuha ang libreng mapa ng mga eksibit.

46. Effective use of emphasis can enhance the power and impact of communication.

47. Lumapit siya sa akin at sumandal sa may sink.

48. Puwede ka ba sa Miyerkoles ng umaga?

49. Dahil sa magandang boses at musika, nahuhumaling ako sa panonood ng mga musical plays.

50. I don't think we've met before. May I know your name?

Recent Searches

maalogprocesokwebangmemorialchoiceproperlybusyangnilinisbellconventionallegislativeaniteachmulihallumiilingdevelopedclimbeddulaspeechwealthaleatevisfloorexpertfinishedpointhapdibathalawouldcrazydanceventaincreasednagtungomessagenasaktanayantechnologicalsmallseparationelectedbroadcastingnamungacontinuedtagumpaysinampalapologeticbetaadmiredlulusogtakesbestidainilingtakboinvesting:ailmentsmakikikainnapakamotconocidosticketpagkakapagsalitaadvertising,pagluluksakinahuhumalingannakaliliyongsikre,nakatayomaka-yonagkakasyakagandahagmarketplacessportsmemorysinimulanminu-minutobestfriendtuluyanpinahalatanananaghilipalaisipansinusuklalyannakataaskontratamakauwikinalakihankamiaskulungandumadatingatensyongtatayonaiyakmagsi-skiingpagmamanehonalagutannaghuhumindignami-missguitarramakuhanaliwanaganmagkaharaphintayinmagtatakapaulit-ulittuktokdiyaryotumalonmusicalesmamahalinsakyankoreapantalonghistoriabangkangpapalapitnakaakyatfollowedkanayangisinamanatitirangnagsimulanaglabamaawaingnangalaglagpnilitnapapasayasaglitsidobankhinukaymaligayasahigctricassigurokatolikokaniyaexperience,pinilitcredit3hrskamalayanlihimcareerrememberedgreatlyrolandgjortcashlistahanadditionally,kahusayanbigonghotelcondopamamahingapinalayasmadungiscementedpagkalitoelectoralrosellepasensyadenneherramientahundredwasakasoamopasalamatanarguekahilinganpalangsetyembrepaghuhugaspagongtoothbrushipinadalamadamibuwanmaisgenebutihingmalinispasyayoubugtongdisyemprecommissionperasaantsaaspaeasiercadenawellpasokfatsinunggabansapot