Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

6 sentences found for "choice"

1. Emphasis can be achieved through various means, such as tone of voice, body language, and word choice.

2. Environmental protection is not a choice, but a responsibility that we all share to protect our planet and future generations.

3. Forgiveness is a choice that can bring healing and peace to both the forgiver and the one being forgiven.

4. Meryl Streep is considered one of the greatest actresses of all time, with numerous award-winning performances in films like "The Devil Wears Prada" and "Sophie's Choice."

5. No choice. Aabsent na lang ako.

6. Omelettes are a popular choice for those following a low-carb or high-protein diet.

Random Sentences

1. Si quieres que la comida esté picante, agrega un poco de jalapeño.

2. Samakatwid, walang makapagsabi kung saan nakatago ang gong.

3. The weather is holding up, and so far so good.

4. Los Angeles is considered the entertainment capital of the world, with Hollywood being the center of the film and television industry.

5. The actress on the red carpet was a beautiful lady in a stunning gown.

6. Adequate fiber intake can help regulate the digestive system and maintain gut health.

7. Smoking can negatively impact one's quality of life, including their ability to perform physical activities and enjoy social situations.

8. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

9. Umihip ang malamig na hangin, waring may paparating na masamang balita.

10. El invierno es una época del año en la que las personas pasan más tiempo en interiores debido al clima frío.

11. Hindi siya naging maramot nang magbigay ng kanyang oras para tumulong sa proyekto.

12. I always wake up early to study because I know the early bird gets the worm.

13. She does not gossip about others.

14. Some people are allergic to pet dander and should take this into consideration before adopting a pet.

15. Ang saya saya niya ngayon, diba?

16. He is not having a conversation with his friend now.

17. Sí, claro, puedo confirmar tu reserva.

18. The stock market gained momentum after the announcement of the new product.

19. I am absolutely confident in my ability to succeed.

20. Ang pag-awit ng mga kanta at pagtugtog ng tradisyunal na musika ay bahagi ng pagdiriwang ng Chinese New Year.

21. Pakibigay na lang sa punong-guro ang liham ng mga magulang mo.

22. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

23. Pakibigay sa akin ang listahan ng mga paalala bago ako maglakbay.

24. Cancer is a leading cause of death worldwide, and millions of people are diagnosed with cancer each year.

25. Nakapagtala ang CCTV ng larawan ng salarin na lumabas sa pagsasagawa ng krimen.

26. Nakakatuwa ang maliliit na kubyertos na ibinibigay sa mga bata sa mga children's party.

27. Remember that the most important thing is to get your ideas and message out to the world

28. Where there's smoke, there's fire.

29. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

30. Sweetness can be enjoyed in moderation as part of a balanced and healthy diet.

31. Investing in the stock market can be risky if you don’t do your research.

32. Las escuelas públicas son financiadas por el estado y son gratuitas para los estudiantes.

33. Bakit ba gusto mo akong maging bestfriend?!

34. Maraming ideya na ibinibigay ang brainly.

35. Mahilig akong makinig ng music kaya laging nahuhumaling sa mga bagong kanta.

36. Mahirap magsalita nang diretsahan, pero may gusto ako sa iyo.

37. Make use of writing software and tools, they can help you to organize your thoughts and improve your writing

38. Det er også vigtigt at spise en sund og afbalanceret kost for at støtte ens træningsmål og sundhed generelt.

39. Mas romantic ang atmosphere sa dapit-hapon.

40. Hindi ko mapakali ang aking sarili dahil sa aking mga agam-agam tungkol sa aming kasal.

41. Market indices such as the Dow Jones Industrial Average and S&P 500 can provide insights into market trends and investor sentiment.

42. Twitter Moments are collections of tweets and media about specific events or stories, allowing users to catch up on important discussions.

43. He has fixed the computer.

44. Siya ang nagpatuloy sa pag-aagwador.

45. Hindi maunawaan ni Bereti ngunit eksayted siya sa buhay nina Karing.

46. Si Jose Rizal ay napakatalino.

47. Inakalang nalimutan siya ng kaibigan, pero nagulat siya sa sorpresa nito.

48. Ayaw ko magtangkang magbiyahe nang walang mapa.

49. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

50. Being aware of our own emotions and recognizing when we are becoming frustrated can help us manage it better.

Recent Searches

choicecivilizationklimaexcusecupidpagodomgbigotebilugangmakipag-barkadanaguguluhangnakalilipasagam-agamsaleyeynagtatanongkapangyarihangalikabukinadmiredduonubonagsisipag-uwiannakapagngangalitculturakumembut-kembotmakikikainflyvemaskinerpagmamanehonagawangmakasilongpamilyangpinapasayatumahimikpagbahingdyipnaglulutodispositivohayaangpaghahabipaghaharutansulyapnovelleshahatolsakenbayanikalabanumokaybintanaparusahankasohinanakitiyamotnakapapasongoxygenbunutanmaramotipinambiliadvertisingmatulunginkauntigawingakmangsumusulatilocosbalanglinawlenguajepanindangpeppymatarayhoymasipagbumababawarivalleymaduraspaghinginiligawananiyacomputere,yatabusystrategytextocadenapedebarriersjackymajorformasreducedmonetizingeverywayslimitpopulationfatalareabosesoftedoble-karatawanantrasciendehagdanandilagsomethingincludewhetherwithoutandremonitormaratingrinjohntatawagarturocommercialsuotmartiankahuluganglobalabalasystematisk1982exhaustedgayundinnag-usapsurgeryincreasinglypinagkiskisinvestubuhinaksidentemasayakutiskalarodiversidadpakakasalanlayastoretesiyamagagandangprogrammingedit:evolvelabibiyernesjunionakapasaejecutarsamahaniligtasinakyatoncerimasmakisigpumatolpinagsanglaansocialehoweverumibigginisingteknologiinuulamnasasalinanvibratecutsharknakangitilisteninghenrymasayang-masayacapableipinansasahognagpatimplakeepingyeheyoutlinesmabangongtimeinilabaspinapakainnag-emailnapadungawmamitascarolreaderstingnanmorningmakapagmanehoimprovetinatanongpromotenapakaramingmarketingkaninonghumabolhelphearthanggang