Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products:"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. This can include correcting grammar and spelling errors, reorganizing sections, and adding or deleting information

2. At spille ansvarligt og kontrollere ens spillevaner er afgørende for at undgå alvorlige konsekvenser.

3. Los ríos y lagos son fuentes importantes de agua dulce.

4. La inversión en la agricultura es importante para apoyar a los agricultores y la producción de alimentos.

5. Nagpahayag ng reklamo ang mga estudyante dahil sa sobrang lamig sa silid-aralan.

6. Ikinagagalak naming anyayahan kayo sa aming kasal.

7. Ang pagguhit ay puwedeng magbigay ng kasiyahan at fulfillment sa buhay.

8. Kukuha na ako ng lisensya upang makapagmaneho na ako.

9. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

10. Medarbejdere skal overholde arbejdstider og deadlines.

11. Nagsisilbi siya bilang abogado upang itaguyod ang katarungan sa kanyang kliyente.

12. Grabe naman ang lockdown na yan ilang buwan na.

13. Human activities, such as pollution and deforestation, have a significant impact on the environment.

14. Ang kanilang anak ay tinawag nilang Amba.

15. Mi amigo del colegio se convirtió en un abogado exitoso.

16. Nasabi ng binata na ang bunga ay katulad ng matandang madamot na dating nakatira sa lugar na iyon.

17. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

18. At følge sin samvittighed kan være afgørende for at træffe de rigtige beslutninger i livet.

19. Nous avons opté pour une cérémonie de mariage intime.

20. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

21. At ang hawak nitong bangos na tig-bebeinte.

22. Lagi na lang lasing si tatay.

23. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

24. Ilang oras na ang nakalipas ngunit hindi pa nauwi ang batang si Ana, nagpatulong na si Aling Rosa sa mga kapit-bahay na hanapin si Ana.

25. Hockey is played with two teams of six players each, with one player designated as the goaltender.

26. Walang kasing bait si daddy.

27. Disculpe; ¿me puede ayudar por favor?

28. Nagtatanim kami ng mga halamang gamot para sa aming natural na gamutan.

29. Inflation kann auch durch eine Verringerung der öffentlichen Investitionen verurs

30. Basketball has produced many legendary players, such as Michael Jordan, Kobe Bryant, and LeBron James.

31. Las redes sociales también son un medio para hacer negocios y promocionar productos.

32. Les régimes riches en fruits, légumes, grains entiers et faibles en graisses saturées peuvent réduire le risque de maladies chroniques.

33. Limitations can be a result of fear or lack of confidence.

34. Ang mga pagtitipon sa mga pistaan at mga malalaking lunsod ay nagpapakita ng kasiglahan at saya sa pagdiriwang ng Chinese New Year.

35. Hinikayat ang mga turista na lumibot sa mga nakakaakit na tanawin ng naturang isla.

36. He does not break traffic rules.

37. Sweetness can evoke positive emotions and memories, such as childhood nostalgia.

38. At blive kvinde handler også om at lære at håndtere livets udfordringer og modgang.

39. Maaring ibigay ng guro ang libro sa akin.

40. Kucing di Indonesia adalah hewan yang sering menjadi teman dan sahabat bagi pemiliknya.

41. Napansin niya ang takot na takot na usa kaya't nagpasya ito na puntahan ito.

42. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

43. Palibhasa kaaya-ayang pagmasdan ang magandang mukha ng anak nila na pinangalanan na Aya.

44. Drømme kan være en kilde til inspiration og kreativitet.

45. The writer published a series of articles exploring the topic of climate change.

46. Bilin ni Aling Pising na lagi niyang aayusin ang kaniyang buhok upang hindi maging sagabal sa kaniyang mga gawain at pag-aaral.

47. Los blogs y los vlogs son una forma popular de compartir información en línea.

48. Después de la lluvia, el sol sale y el cielo se ve más claro.

49. I am not listening to music right now.

50. Ang lalaki ng paniki na aming nakita.

Recent Searches

reviewsilyatinitindamarangyangproducts:gaanosaboghoysadyangmatamansmilefiverrnilolokohagdankutodsinungalingwalongtupelotagalogblusabinilhanmukagodtbasahinipantalopiyanlandhetobilipogiyunpongknightfitjocelynbecamepatunayannahigakalongkakauntogdugolalawiganpinagsasabiipinabalotyeheybakematatagmakitasurveysputolpaghakbanglalakengbaboygumagamithumayotumigilmag-babaitikatlongmagasinSambitcertainreachkalayuansicahalikanagulatmag-iikasiyamcompostelashopeediamond1940subalitpinatidpitomassestakesprincedream1929makaratinglendinglaryngitisdemocracyresumenmedidakatandaangenecellphonetapebotantelabingresearchnagreplynatingalasumarapdatiotrasgranfraagaunderholderso-calledtingideassumamazoomsoreconectadosabonospeechesfeedback,katabingandamingsutildoneconventionalharmfulspeedputahemapakaliconcernsjamestvsmalapitactingpulastevebumugapalagingcongratsumiilingcoatknowsnathancoaching:manualmind:workdaypowerssafeitlogdanceexitevenconditioningchefpinilingheiboses4thtopic,standdumatingmainitinterpretingpaslitrestmethodsclassessequepagkahaporefsettingtopicjunjuncurrentulinguniquenutstechnologiesamountvanpaceipihitkitpersistent,activitynevercornerbeforecasessetyembreiglapwhiledivisorianilaosibinentatamisexpressionsumangatwalkie-talkiehappyogormaninipiskaloobanmaingaysopascedulamasayang-masayangwasak