Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products:"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Madalas ka bang uminom ng alak?

2. She was already feeling overwhelmed, and then she received a massive bill in the mail. That added insult to injury.

3. Mommy. ani Maico habang humihingal pa.

4. Sweetness can be enhanced with spices, such as cinnamon and nutmeg.

5. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

6. Nakakalasing pala ang wine pag napasobra.

7. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

8. Sa loob ng paaralan, ang ingay ng mga mag-aaral ay binulabog ang kasiyahan ng mga guro.

9. "Manalig ka sa Diyos at hindi ka mapapahamak," ani ng pari sa kanyang sermon.

10. Mabilis ang takbo ng pelikula.

11. And she said yes? parang nag-aalangan kong tanong.

12. The garden boasts a variety of flowers, including roses and lilies.

13. Oo nga, yung last time eh nung birthday ko pa. ani Genna.

14. Musk's SpaceX has successfully launched and landed reusable rockets, lowering the cost of space exploration.

15. Ang mga hudyat ay maaaring maging bahagi ng kultura at lipunan, na may iba't ibang kahulugan sa iba't ibang konteksto.

16. Fathers can also play an important role in teaching life skills and values to their children.

17. Pakibigay ng malinaw na paliwanag sa tanong upang mas madali itong maunawaan.

18. Jeg har fået meget værdifuld erfaring gennem min karriere.

19. He has been writing a novel for six months.

20. Nakita ko ang mga kapatid ko noong pasko.

21. Scientific research has led to the development of life-saving medical treatments and technologies.

22. Users can create profiles, connect with friends, and share content such as photos, videos, and status updates on Facebook.

23. Pumulot siya ng mga bao ng niyog, gamit na panggatong sa apoy, at hinagis sa lola.

24. Ang pagkakalugmok sa pag-aakala ng mga kasinungalingan ay nagpapakita ng pagiging bulag sa katotohanan.

25. Sana po ay maibalik ko pa ang panahon upang mabigyan sila ng kasiyahan.

26. Hindi ka ba papasok? tanong niya.

27. La música es una parte importante de la educación musical y artística.

28. Pupunta ako sa Germany sa susunod na taon.

29. Madalas na may mga internasyonal na konferensya na ginaganap upang mapag-usapan ang mga usaping pangkapayapaan.

30. Ang mga kasiyahan at salu-salo sa hapag-kainan ay nagdudulot ng kasiyahan sa bawat tahanan tuwing Chinese New Year.

31. Effective use of emphasis can enhance the power and impact of communication.

32. Its cultivation on a wide scale with the help of negro-slaves made it one of the major export items in the American economy

33. A king is a male monarch who rules a kingdom or a sovereign state.

34. Nationalism can be a source of inspiration for artists, writers, and musicians.

35. Pinangunahan ni Emilio Aguinaldo ang proklamasyon ng kasarinlan ng Pilipinas noong Hunyo 12, 1898.

36. El paisaje es un tema popular en la pintura, capturando la belleza de la naturaleza.

37. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

38. She has won a prestigious award.

39. She is not designing a new website this week.

40. She attended a series of seminars on leadership and management.

41. Paboritong laro ng kuya ko ang basketbol.

42. Sa gitna ng gulo, pinili niyang mag-iwan ng mga taong hindi naaayon sa kanyang pangarap.

43. Asul ang kulay ng mata ng anak ko.

44. Sa isang iglap siya naman ang napailalim.

45. Maraming paniki sa kweba.

46. Don't cry over spilt milk

47. Ang matanda ay nagalit at pinalayas ang bata.

48. Ang pag-asa ay nagbibigay ng motibasyon sa mga tao upang magpatuloy sa kanilang mga pangarap at mga layunin sa buhay.

49. Ang poot ang nagbibigay sa akin ng lakas at determinasyon upang harapin ang mga hamon ng buhay.

50. Sorry, hindi ako babae eh. sumubo ako ng pagkain ko.

Recent Searches

kinabubuhaynatutulogproducts:baryomagbalikidiomalivealitaptaptsakapag-isipanmasayang-masayaitakwealthdagoktumakbotangannakihalubilolabinsiyambefolkningenbinigayikinabubuhaymaramotkampomatalinodali-dalingmagazinesnasisilawmaskimatagalparemaninirahankagabinanlilimosmatayogdumapacomputeriyakkaano-anoambasarilingmulighedermanilbihanantoniosetscallingnag-aasikasonapilingmalapitproduktivitetpahabolvetobinatopayojaysonkartonpag-iwanininomnakabaonlumagokulunganlupatolkumantatuladhonestonamularimasnakasilongyamansangtinulak-tulakkawayantinaasantugonlinggo-linggobagkustatayhinahanapmarahanbayabasnakabalikbobouhogpangarapnakagawiankilaybopolstimelibolumibothahatolboxingbowsummerpostoperateresignationnapakamisteryosomamayanagkakatipun-tiponnagagamitmwuaaahhstudiedroompowerlinapinanoodsilbingnapagsilbihannagpapaitimmelvinnatingalamejoioshateextremistbossmaskinertuvobahagyamind:therekahoypetsangparkpagkababaoperasyonnapatulalanapapahintonamamayatnakaraannagingmemoriamarangyangmamayangmakakatalokumalmakiniligagosikinasasabiknagtungoh-hindicountlessyoungulostyrerqualityeffectpoolpolohumahabanalagutannagdudumalingnagmasid-masidnaintindihandiyannaghandasalbahengmedikalmagtiislaamangkalangulogospelfoundumilingerlindaenchantedbalahibotangoschoolpinakidalanaglabananmindanaomagsasamakasintahankapilingisamamatagumpaydataslaveaddresspatingmag-uusapdyosadesarrollaronhalosayusinpagkamulatmalungkotpondoabrilmayabongfreejaceboksingorasperapioneerngunit