Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products:"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Malaki ang kama sa kuwarto ni Olivia.

2. Anong pangalan ng lugar na ito?

3. Hi, we haven't been properly introduced. May I know your name?

4. They are not cleaning their house this week.

5. Virksomheder i Danmark, der eksporterer varer, er afgørende for den danske økonomi.

6. Hairdressing scissors, also known as shears, have different blade designs for different cutting techniques.

7. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

8. Spillene kan også være afhængige af held, dygtighed eller en kombination af begge dele.

9. Maglalaba ako bukas ng umaga.

10. Babalik ka pa ba? nanginginig na yung boses niya

11. Pagkaraan ng ilang araw ay magaling-galing na si Aling Rosa.

12. Baket? nagtatakang tanong niya.

13. Ailments are physical or mental health conditions that cause discomfort or illness.

14. Mag-uusap kami sa makalawa ng tanghali.

15. May tatlong bituin ang watawat ng Pilipinas.

16. Receiving recognition for hard work can create a sense of euphoria and pride.

17. Les voitures autonomes utilisent des algorithmes d'intelligence artificielle pour prendre des décisions en temps réel.

18. They plant vegetables in the garden.

19. Hindi pa rin makapagsalita si Mang Kandoy.

20. Natawa ako sa maraming eksena ng dula.

21. He was already feeling sad, and then his pet passed away. That really added insult to injury.

22. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

23. Naging tamad ito sa pag-aaral at sa mga gawaing bahay.

24. Naging bahagi siya ng agaw-buhay na rescue mission upang iligtas ang mga tao sa panganib.

25. Oy saan ka pupunta?! sigaw nya.

26. Ailments can be acute or chronic, meaning they may last for a short period of time or a long period of time.

27. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

28. Tumango lang ako. Wala ako sa mood na magsalita.

29. Hawak niya yung kamay ni Gelai habang palapit sa amin.

30. Las escuelas privadas requieren matrícula y ofrecen diferentes programas educativos.

31. Technical analysis involves analyzing past market trends and price movements to predict future market movements.

32. Nagsusulat ako ng liham upang ipahayag ang aking pasasalamat.

33. Scientific evidence suggests that global temperatures are rising due to human activity.

34. Ang aming mga pangarap at layunin ay pinagsasama namin bilang magkabilang kabiyak.

35. Amazon has faced criticism over its treatment of workers and its impact on small businesses.

36. LeBron James is a dominant force in the NBA and has won multiple championships.

37. If you want to get the best deals at the farmer's market, you have to be the early bird.

38. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

39. Ang mga halaman sa bukid ay natutuyo dahil sa matinding tagtuyot.

40. Laughter is the best medicine.

41. Jagiya? hinde parin siya umiimik, Ya Kenji.

42. Ant-Man can shrink in size and communicate with ants using his helmet.

43. Eine schwere Last auf dem Gewissen kann uns belasten und unser Wohlbefinden beeinträchtigen.

44. Pasensya na pero kailangan ko nang umalis.

45. Nakatayo siya sa gilid ng bangin, waring nag-iisip nang malalim.

46. Ipinakita ng dokumentaryo ang mga kaso ng abuso sa mga nakakulong na bilanggo.

47. Maaaring magkaroon ng interest at late fees kapag hindi nabayaran ang utang sa tamang panahon.

48. Después de la tormenta, el cielo se vuelve más oscuro y las nubes se alejan.

49.

50. Ang mga palaisipan ay maaaring magpakita ng mga patlang sa kaalaman at kasanayan ng isang indibidwal.

Recent Searches

products:silyakahilinganrevolutionizedairconmalakibinatanganaysaylotadicionaleslaryngitissumandalhalagapaabitbitnanaysarilingbalikatamazonnapilingledpigiibonnagiislowcaketiniklinginyongkahapontakipsilimnapadpadnaramdamanfionavalleypaanocompartenspellingnagpipiknikexperiencespumuntaprosperdeletinglumayasumagapulismarchmagpasalamatmagpapaligoyligoytransmitsnag-emailpalapitdapattengapayapanggenerabanag-uwitwo-partybumabagbobotomabagalomkringnakikisalosaktansiopaonalangmatumalkarangalanigigiittsinelaslacknyatrainsgumagalaw-galawisinakripisyobathalapaglapastangandyippleasepagkabatainilingcoravetoorasattentionsupilinhistorynalalabingduranteimeldaditojoekongpananakitmagpaniwalanobodysalitatinionilaumiibigburolpaslitgenerationeruponasapagpapasakitgeneratedclaranag-away-awayhaponafterdadalawknownmessageasiaticpinagkaloobansonnakainmaligayadali-dalingayonseemahigitpopularlaranganviewpitakavarietyprocesstinataluntonilagaygreatlycontinuedestablishedharingpakibigyanbiyernesmartaunconstitutionalkaniyatermformasjuegositinanimpoliticsmakalipasflywritingkatienabalotunfortunatelymatalinopssszoomindvirkningnaghandayepabriluponkaloobanwaringbasainternasomethingsistemamalaki-lakisang-ayonpag-aminimportantenapotalentmalumbaypinatawadsetyembresikatgoalhinogusasignpabalanglawssukatclasesparagraphswalangusequeinaaminwhatevermensahesinigangfiststodasnationalgawingsarapkamipatingshowspinangalanangbinabalik