Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

23 sentences found for "products:"

1. Affiliate marketing: If you have a blog or social media following, you can earn money by promoting other people's products and earning a commission on any sales you generate

2. Amazon offers a wide range of products and services, including electronics, clothing, books, music, and more.

3. Amazon's Alexa virtual assistant is integrated into many of its products, including the Echo smart speaker.

4. Bawal magpakalat ng mga fake products dahil ito ay nagdudulot ng kawalan ng seguridad sa kalusugan at kaligtasan ng mga mamimili.

5. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

6. Calcium-rich foods, such as dairy products and tofu, are important for bone health.

7. Emphasis is often used in advertising and marketing to draw attention to products or services.

8. Lazada has a social commerce feature called Lazada TV, which allows customers to buy products directly from influencers and celebrities.

9. Lazada has faced criticism over counterfeit products being sold on its platform.

10. Lazada has launched a live streaming feature that allows sellers to showcase their products and interact with customers in real-time.

11. Lazada has partnered with local brands and retailers to offer exclusive products and promotions.

12. Lazada offers a fulfillment service called Fulfillment by Lazada (FBL), which allows sellers to store their products in Lazada's warehouses and have Lazada handle shipping and customer service.

13. Lazada offers a wide range of products, including electronics, fashion, beauty products, and more.

14. Musk has faced criticism over the safety of his companies' products, such as Tesla's Autopilot system.

15. Selling products: You can sell products online through your own website or through marketplaces like Amazon and Etsy

16. Smoking can be addictive due to the nicotine content in tobacco products.

17. Smoking can have financial implications due to the high cost of tobacco products and healthcare costs associated with smoking-related illnesses.

18. The beauty store has a variety of skincare products, from cleansers to moisturizers.

19. The company burned bridges with its customers by providing poor service and low-quality products.

20. The company launched a series of new products, targeting different customer segments.

21. The store offers a variety of products to suit different needs and preferences.

22. The website's online store has a great selection of products at affordable prices.

23. This could be physical products that you source and ship yourself, or digital products like e-books or courses

Random Sentences

1. Smoking is influenced by various factors, such as peer pressure, stress, and social norms.

2. Cancer patients may receive support from various healthcare professionals, such as oncologists, nurses, and social workers.

3. God is a concept of a supreme being or divine force that is often worshiped and revered by religious communities.

4. La esperanza es un recordatorio de que siempre hay algo bueno en el futuro, incluso si no podemos verlo en el momento. (Hope is a reminder that there is always something good in the future, even if we can't see it at the moment.)

5. Ito na yata ang pinakamatabang babae na nakilala niya.

6. I have lost my phone again.

7. Ang buhay at mga akda ni Rizal ay patuloy na pinag-aaralan at pinag-aaralan ng mga estudyante at mga historyador sa buong mundo.

8. Ang mga tradisyunal na parada ay isang kakaibang aspeto ng Chinese New Year.

9. Transkønnede personer kan opleve diskrimination og stigmatisering på grund af deres kønsidentitet.

10. Nagbigay ng pahayag ang alkalde ukol kay Maria tungkol sa mga plano para sa lungsod.

11. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

12. Bukas na daw kami kakain sa labas.

13. Siya ang may pinakamataas na grado sa klase, samakatuwid, siya ang napiling valedictorian.

14. May bukas ang ganito.

15. Saan na po kayo nagtatrabaho ngayon?

16. Malungkot ka ba na aalis na ako?

17. Sa aksidente sa kalsada, maraming tao ang nasugatan at ilang pasahero ang namatay.

18. Ang palaisipan ay isang uri ng suliranin na nangangailangan ng matinding pag-iisip upang malutas.

19. "Ang taong nagigipit, sa patalim kumakapit" ay isang bukambibig na nagpapakita ng kakayahan ng tao na gumawa ng mapanganib na mga hakbang kapag sila ay nasa kritikal na sitwasyon.

20. Dahil sa sobrang ganda ng lugar, nahuhumaling ako sa pagba-vacation sa ibang bansa.

21. The doctor measured his blood pressure and diagnosed him with high blood pressure.

22. Les maladies mentales sont souvent mal comprises et stigmatisées dans de nombreuses cultures.

23. Dahil sa pagod, naupo ang matanda sa ilalim ng nasabing puno upang makapagpahinga.

24. Nagitla ako nang biglang tumunog ang emergency alarm sa opisina.

25. La paciencia es una virtud.

26. Mahalagang igalang ang kalayaan ng ibang tao sa pagpapasiya ng kanilang mga sariling buhay.

27. Denne kombination har vist sig at være meget effektiv i at skabe en høj grad af velstand og velfærd for befolkningen

28. Instagram has become a platform for influencers and content creators to share their work and build a following.

29. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

30. Salatin mo ang pader at hanapin kung saan ang crack.

31. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

32. Pinaayos ng paaralan ang ilaw sa silid-aralan upang hindi na magkakaroon ng problema sa lighting.

33. Ang pagtanggap ng tubig-ulan ay isa sa mga pamamaraan ng pagtitipid ng tubig sa panahon ng tagtuyot.

34. Ang taong hindi marunong lumingon sa pinanggalingan, ay hindi makakarating sa paroroonan.

35. The Griffith Observatory offers stunning views of the city's skyline and is a popular tourist attraction.

36. Mahirap magluto ng pulotgata dahil kailangan ng tamang timpla.

37. The athlete's hefty frame made them well-suited for their position on the team.

38. Las hojas de los árboles proporcionan sombra y protección contra el sol.

39. They are building a sandcastle on the beach.

40. Pagkatapos ng ulan, naging maaliwalas ang kapaligiran.

41. The hotel might offer free breakfast, but there's no such thing as a free lunch - the price of the room is probably higher to compensate.

42. It is important to take breaks and engage in self-care activities when experiencing frustration to avoid burnout.

43. Mayroon umano siyang lihim na kayamanan na itinago sa loob ng maraming taon.

44. This is a tough situation, but we'll get through it if we hang in there.

45. Nakaupo ang babaeng nakasuot ng salamin.

46. Dirk Nowitzki, a 7-foot power forward, is considered one of the best international players in NBA history.

47. The restaurant was full, and therefore we had to wait for a table.

48. Pakibigay mo naman ang libro kay Anna para magamit niya sa kanyang takdang-aralin.

49. Maraming mga mahuhusay na maghahabi ang tumaggap sa hamon ng batang si Amba.

50. Los Angeles is famous for its beautiful beaches, including Venice Beach and Santa Monica Beach.

Recent Searches

masipagdeterminasyonproducts:hinabolwednesdaymatamanluneskunwadrayberdikyamiyanedsaiconshappenedibinalitangaksidenteadditionally,carbonbalotnogensindekaugnayannaglabananassociationwalongreguleringtapemembersinterestsdinanasalamidapoymedyokinsechoipataysong-writingwalngencompassespangingimituwingsyavalleyxixmorenatapatblazingparikrusgamitinatentoklimasorecryptocurrency:systematiskmayodilimmagdapartyaccederbarnesbriefbellanousedsaringcoatyanformasbaulbipolarnamingpersonalrestawandyanpromotingsedentarykiloexpectationstargetgrabestrengthfaulttrackpupuntaoperatengpuntainsteadremoterepresentativepersistent,doingpatricknotebooktechnologicalnaiinggitdingginfullsamalimitnasusunogskabtpagkakapagsalitamagkabilangmaidcommercialpagkaimpaktolaki-lakipanghihiyangpandidirigymitoeditorpooreradditionallytwogulangnagkwentopamilyangnagkapilatpinakabatangnakatiranagtuturonakakagalanagsasagotnaglalarosalekalayaankawili-wilimaipantawid-gutomdadadividestulisannag-iinomkagandahagmagkaibigannaglipanangmanamis-namisnagtagisanagricultoresmagkasintahannagliliwanagnakakatulongmagkaibangmanghikayatpinaghatidanemocionantediscipliner,isasabadpagkalitonakuhangbiologimakalipasmirapalancafilipinapinakidalatatayomagkaharapbabasahinkapasyahanpagsisisideliciosakabuntisannaglarocoachingmagbibiladkuryentemakasalanangkalabawmahinanami-missuugod-ugodinaaminnalalabingnaliwanaganngumiwinaghilamoslumutangskirtnapuyatiniindacompanyyouthintindihinvideosdesisyonanyumabangledpinangaralanpakiramdamafternoonnaabotminatamiscanteenginawangfysik,miyerkulestumigilsanggolpaos