Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

2 sentences found for "password"

1. Pwede ko ba malaman ang password ng inyong wifi?

2. Walang password ang wifi ng kapit-bahay.

Random Sentences

1. Masyadong maaga ang alis ng bus.

2. Besides, for no fault of their own even persons who are liable to inhale cigarette smoke when in the company of a smoker may suffer from any of these diseases

3. Ang mobile legends ay sikat na sikat sa mga pinoy.

4. The invention of the telephone can be traced back to Alexander Graham Bell, who is credited with patenting the first practical telephone in 1876

5. Ang daming pulubi sa maynila.

6. I am exercising at the gym.

7. Captain Marvel possesses cosmic powers and is one of the most powerful superheroes in the Marvel Universe.

8. Otro festival importante es el Festival Internacional de Música y Danza de Granada, que se celebra en junio y presenta una amplia variedad de géneros musicales

9. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

10. The role of a father has evolved over time, with many fathers taking on more active roles in child-rearing and household management.

11. Les personnes âgées peuvent avoir des difficultés à mémoriser et à apprendre de nouvelles informations.

12. Nagdisko kami kamakalawa ng gabi.

13. Las plantas trepadoras, como las enredaderas, utilizan estructuras especiales para sujetarse y crecer en vertical.

14. Pagkatapos ng isang daang metro kumanan ka.

15. Las labradoras son excelentes perros de trabajo y se utilizan a menudo en búsqueda y rescate.

16. Party ni Lory? nabigla sya sakin sa sinabi ko.

17. Ang pagpapakalat ng mga maling impormasyon ay nagpapakita ng pagiging bulag sa katotohanan.

18. Nag-aalalang sambit ng matanda.

19. LeBron has used his platform to advocate for social justice issues, addressing inequality and supporting initiatives to effect positive change.

20. Ang pagkamatay ni Rizal ay naging simbolo ng paglaban sa kolonyalismo at pampulitikang opresyon sa Pilipinas.

21. Alam ko maraming uncertainties sa buhay, pero sana pwede ba kitang mahalin?

22. Siya ang nagpatuloy sa pag-aagwador.

23. Siempre me preocupo demasiado por las cosas, pero debería recordar que "que sera, sera."

24. Sa pagdiriwang ng fiesta, ang bayanihan ay nagiging mas makikita sa paghahanda at pagdaraos ng mga aktibidad.

25. The Lion King tells the tale of a young lion named Simba who must reclaim his kingdom from his evil uncle.

26. Kailangan mong higupin ang gamot gamit ang straw.

27. Ipinagtanggol ng mga obispo ang doktrina ng purgatoryo sa kanyang homiliya.

28. Elektronik kan hjælpe med at forbedre sundhedspleje og medicinsk behandling.

29. Television also plays an important role in politics

30. Regular exercise can help to maintain healthy blood pressure levels and prevent high blood pressure.

31. They walk to the park every day.

32. The lightweight fabric of the dress made it perfect for summer weather.

33. Dahil sa kagustuhan ng mga tao na matuto ng iba't ibang wika, yumabong ang mga language schools sa bansa.

34. El equipo de recolección mecánico es muy eficiente para cosechar grandes extensiones de tierra.

35. Marahil ay maaga kang dapat umalis upang makarating sa pupuntahan mo sa oras.

36. Sa aking hardin, ako ay nagtatanim ng mga bulaklak.

37. Dahil sa biglaang pagkawala ng kuryente, hindi ako makapagtrabaho kanina.

38. Magsasalita na sana ako ng sumingit si Maico.

39. Sa Sabado, alas-diyes ng umaga.

40. I complimented the pretty lady on her dress and she smiled at me.

41. Pagkatapos pumili ng lugar, dapat mong magsimula sa pamamagitan ng pagpapakalat ng compost o fertilizer sa lupa bago magsimula sa pagtatanim

42. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

43. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

44. Ang ganda naman nya, sana-all!

45. Sa isang malakas na bagyo, hindi ko na nakita ang aking mga kasama dahil sa sobrang pagdidilim ng paningin ko.

46. Binigyan sya ng dentista ng gamot matapos syang bunutan ng ngipin.

47. Es importante elegir un powerbank de buena calidad para garantizar una carga segura y eficiente.

48. The transmitter and receiver were connected by a network of wires, which allowed the signals to be transmitted over long distances

49. Hashtags (#) are used on Twitter to categorize and discover tweets on specific topics.

50. His presidency was marked by controversy and a polarizing political climate.

Recent Searches

passworddonefiverrlayout,dependingipinalitdumaramiadaptabilitystringputingliv,magpagalingnagtataasdekorasyonturismomagbabagsikbagoskills,anyonahawakandisenyongpagpapautangsalecharmingpinakamaartengenfermedades,sponsorships,artistasikinalulungkotnaka-smirkpinagalitanreserbasyonpaki-translatenagulathealthierencounterpagkakayakapnapaplastikanmedya-agwakaharianpinuntahankabundukannakikiakapamilyalumikhapaghihingalopresleynatinkomedornapagtantototoongenglandkidkirannakasakitbasedkissnalalabingkinasisindakanscientificpangungusaphandaantinangkangmalapalasyopaki-chargesagasaankahoypaninigasnatabunantinataluntongiyeranakakaanimnakatuonhanapbuhaytaglagasvideosnagagamitlumilipadmarioika-50patawarinpakiramdammagselos1970spagbabantabasketbollagnatmabagalnaliligonakaakyatiniuwikampeonhinugotisinarakababalaghangnakapikithinatidsunud-sunodmakausappagiisipmakisuyobighanitindahanbilihinsakalingrememberedrevolutioneretlabistayorepublicankapalkumustatilifederalperseverance,diliginnangingilidmahigpitlaganapmatangkaddealkalalakihaneyasandalihoteltsuperhagdanmatesao-ordertsinelasmanilasikipsellingmaisipasianapapatingintalentdibalenguajeconsumefriendstokyobalatchickenpoxmeronkulotpublicationkatagalankasalananmrslaryngitisinulitarguegraphicmakasarilingmukaadopteditutolparangnagnaggalazooclientspanahontuwanglingidprinceduonpeacemamulotreplacedbarrocolapitanpagodhehediagnosticitimgabeso-calledbugtongpakpakkalakihanmajorjoshwalangzoompostcardnilangotrasjackzstillscienceofferspeedellensumapitpulaoutpostperangcadenairog