Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "hard"

1. After months of hard work, getting a promotion left me feeling euphoric.

2. All these years, I have been working hard to achieve my dreams.

3. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

4. I can't believe how hard it's raining outside - it's really raining cats and dogs!

5. I know this project is difficult, but we have to keep working hard - no pain, no gain.

6. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

7. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

8. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

9. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

10. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

11. Receiving recognition for hard work can create a sense of euphoria and pride.

12. She had been studying hard and therefore received an A on her exam.

13. She studies hard for her exams.

14. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

15. There were a lot of options on the menu, making it hard to decide what to order.

16. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Pinagsulat si Jayson ng pangungusap sa pisara.

2. Anong oras mo gustong umalis ng bahay?

3. Pinili niyang magtungo palayo sa gulo upang makahanap ng katahimikan.

4. Marahil anila ay ito si Ranay.

5. Andre helte er kendt for deres humanitære arbejde.

6. Mas pinapaboran ko ang pulotgata kaysa sa kendi kapag gusto ko ng matamis na panghimagas.

7. Ah opo, ngayon ko lang napagtanto ng sinabi nya yun.

8. The momentum of the protest grew as more people joined the march.

9. Martabak adalah makanan ringan yang terbuat dari adonan tepung dan isian kacang, daging, atau keju.

10. Kapag walang magtutulungan, walang magtatagumpay.

11. Malakas ang kamandag ng ahas na nakatuklaw kay Mang Arturo.

12. Bakit, saan ba ang iyong kaharian? malambing na tugon ng prinsesa.

13. Goodevening sir, may I take your order now?

14. At have håb om en bedre fremtid kan give os troen på, at tingene vil blive bedre.

15. The United States has a strong tradition of individual freedom, including freedom of speech, religion, and the press.

16. Maaga kaming nakarating sa aming pupuntahan.

17. AI algorithms can be used to analyze large amounts of data and detect patterns that may be difficult for humans to identify.

18. Siya ay hinugot ng mga pagsubok sa buhay ngunit hindi siya sumuko.

19. Ang ganda ng sapatos ni Junjun.

20. The company's stock market value has soared in recent years, making Tesla one of the most valuable automakers in the world.

21. Ipinambili niya ng damit ang pera.

22. Football players must have good ball control, as well as strong kicking and passing skills.

23. Siya ay marunong mag-gitara, bagkus walang talento sa kahit anong instrumento siya.

24. Oo naman. I dont want to disappoint them.

25. Omelettes are a popular choice for those following a low-carb or high-protein diet.

26. Ano ang malapit sa eskuwelahan?

27. Menghadapi tantangan hidup dengan keberanian dan tekad dapat membantu kita tumbuh dan mencapai tujuan yang kita impikan.

28. The company's board of directors approved the acquisition of new assets.

29. Pakitimpla mo ng kape ang bisita.

30. Ang edukasyon lamang ang maipapamana ko sayo.

31. Nakikita mo ba si Athena ngayon?

32. Pagkasabi nya nun bigla syang ngumiti agad, Walang bawian.

33. The writer published a series of articles exploring the topic of climate change.

34. She does not skip her exercise routine.

35. Ano ho ang gusto ninyong orderin?

36. Napatingin kaming lahat sa direksyon na tinuturo ni Jigs.

37. Saka dalawang hotdog na rin Miss. si Maico.

38. Los sueños son una forma de imaginar lo que podemos ser y hacer en la vida. (Dreams are a way of imagining what we can be and do in life.)

39. Ang tulang ito ay may petsang 11 Hulyo 1973.

40. Mahigit sa pitong libo ang isla sa Pilipinas.

41. Has he started his new job?

42. Kung gusto may paraan, kung ayaw may dahilan.

43. When I arrived at the book club meeting, I was pleased to see that everyone there shared my love of literary fiction. Birds of the same feather flock together indeed.

44. Makikita mo sa google ang sagot.

45. Sa ikauunlad ng bayan, disiplina ang kailangan.

46. Dinig ng langit ang hiling ni Waldo upang ang paghihirap nila ay mabigyan ng wakas.

47. Madalas ka bang uminom ng alak?

48. Ngunit naglahong parang bula si Pinang.

49. Kinuha naman nya yung isang bote dun sa lamesa kaso.

50. Indonesia adalah negara dengan keragaman agama yang besar, termasuk Islam, Kristen, Hindu, Buddha, dan lain-lain.

Similar Words

hardin

Recent Searches

hardpinunitperafuncioneskararatinggameagosmuchoshalu-halokansertuwang-tuwaespanyangmalikotnageenglishmandirigmangrenehunimagkasabaytaga-suportabumaliknakalabaskinapanayamjobssurgerysorryhistoriastherenaaalalaayonnagturoarbejderbyggettaong-bayantumindigpanahonnapakabutihinanapaplicacionesbooksphilippineangalpalakaligayaartiststonyriyanreorganizingsinkbutterflynag-aasikasobusyangnakararaantatawaganpagbebentabeginningsipapainitomelettekalagayano-onlinehatinggabiinabotparinumagangsilid-aralankirotlingidcirclewishingkamaysabihinconnectnakakaanimbodegamagseloscomplexinfluentialdangerousmerebaryofurthertanimdispositivoslapatminabutilungkotpaghangakatutubodrinkspunong-kahoykasalananabstainingsumungawina-absorveyongpintoconventionalsuzetteyouthmasaksihanflyvemaskinernakikini-kinitanakikiapagpapatuboisasabadlivemakatarungangpakpaknangangaralpulang-pulahumahangosressourcernenakasandigshouldcultivafilipinamangagilamedikalnagbibigaytitatumatawagnaiilagannaabutanunattendedtaglagasdesisyonantungkodnakatalungkobalikatsumusulatkasamaangsasakyannagtapostog,debatesistasyonadgangpundidomakaiponpaidsignalaayusinkirbyvaledictorianexitsumindiumokayisasamasumalakaypagongcynthiamedya-agwapokersidotataasvelfungerendeanaklilipadakmangtagalnagwikangipinambilikumustafitplatformsbigonggardenumakyatmataraybundokmanilamadalingrestawranangkanbarrerasbumotosumuotairconmalamangnagpuntaplasapatunayandaladalatransmitidaspangithinigitparolumulusobbiliboholdikyamhopeartistbranchkantonoolegislationyepmayroonkape