Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

16 sentences found for "hard"

1. After months of hard work, getting a promotion left me feeling euphoric.

2. All these years, I have been working hard to achieve my dreams.

3. Hun har en figur, der er svær at ignorere. (She has a figure that's hard to ignore.)

4. I can't believe how hard it's raining outside - it's really raining cats and dogs!

5. I know this project is difficult, but we have to keep working hard - no pain, no gain.

6. If you're hoping to get promoted without working hard, you're barking up the wrong tree.

7. In conclusion, making a book is a creative and fulfilling process that requires planning, research, and hard work

8. It's hard to break into a new social group if you don't share any common interests - birds of the same feather flock together, after all.

9. It's hard to enjoy a horror movie once you've learned how they make the special effects - ignorance is bliss when it comes to movie magic.

10. It's so loud in here - the rain is coming down so hard it's like it's raining cats and dogs on the roof.

11. Receiving recognition for hard work can create a sense of euphoria and pride.

12. She had been studying hard and therefore received an A on her exam.

13. She studies hard for her exams.

14. Successful entrepreneurs attribute their achievements to hard work, passion, and unwavering dedication.

15. There were a lot of options on the menu, making it hard to decide what to order.

16. Writing a book is a long process and requires a lot of dedication and hard work

Random Sentences

1. Ang utang ay maaaring maging mabuting paraan upang matugunan ang mga pangangailangan sa panahon ng kawalan ng sapat na pera.

2. Las hojas de otoño son muy bonitas en la ciudad.

3. La comida que preparó el chef fue una experiencia sublime para los sentidos.

4. The momentum of the wave carried the surfer towards the shore.

5. They have seen the Northern Lights.

6. Si Emilio Aguinaldo ang unang pangulo ng Republika ng Pilipinas.

7. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

8. Kung hindi ka interesado, okay lang, pero sana pwede ba kita ligawan?

9. Nagsusulat ako ng mga pangako sa aking mga minamahal sa mga espesyal na okasyon.

10. The dog barks at strangers.

11. Hindi ko gusto ang kanyang maarteng pananalita tungkol sa kanyang pagkain.

12. "Ang hindi marunong lumingon sa pinanggalingan ay hindi makakarating sa paroroonan" ay isang bukambibig na nagpapaalala na mahalaga ang pag-alala at pagpahalaga sa mga pinagmulan.

13. Las redes sociales son una plataforma para compartir fotos y videos.

14. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

15. Ang sugal ay maaaring maging isang malaking hadlang sa pag-unlad at pag-abot ng mga pangarap sa buhay.

16. Tila masaya siya, ngunit may lungkot sa kanyang mga mata.

17. Napabayaan na nga ang diyosa ng mga tao at hindi na nag-aalay ng bulaklak sa kaniya.

18. Eine gute Gewissensentscheidung zu treffen, erfordert oft Mut und Entschlossenheit.

19. Nais niyang makalimot, kaya’t naglakbay siya palayo mula sa kanyang nakaraan.

20. L'intelligence artificielle peut aider à la conception de médicaments plus efficaces.

21. Limitations can be perceived as weaknesses, but they can also be strengths and opportunities for growth.

22. Real estate investing: Invest in real estate through online platforms like Fundrise or Roofstock

23. Binigyan niya ng kendi ang bata.

24. Gusto kong magbasa ng libro, datapwat hindi ko alam kung anong libro ang pipiliin ko.

25. Amazon's Kindle e-reader is a popular device for reading e-books.

26. Ang hirap naman ng exam nakaka bobo.

27. Durante las vacaciones de invierno, me encanta esquiar en las montañas.

28. The child was too young to receive the pneumonia vaccine and needed to be protected from exposure.

29. Sa dapit-hapon, masarap magbasa ng libro habang nakatambay sa balcony.

30. Más vale tarde que nunca. - Better late than never.

31. Algunas serpientes son conocidas por su capacidad para camuflarse en su entorno, lo que les permite acechar a sus presas de manera efectiva.

32. Napakalaki talaga ng isla sa boracay.

33. Ang pasya nang pagkapanalo ay sa tela ng matanda.

34. Hindi malinis ang tubig na iyan, bumili ka ng iba.

35. Sa kanya rin napapatingin ang matatanda.

36. The amount of knowledge that exists in the world is immeasurable.

37. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

38. Oy oy! Tama na yan baka maaksidente tayo!

39. Iparating mo ang mensahe sa mahal na hari.

40. Bilang paglilinaw, hindi mandatory ang pagsali sa aktibidad na ito.

41. Athena magpagaling ka.. sabi naman ni Abi.

42. Tumawa nang malakas si Ogor.

43. Ikinalulungkot ko ang balitang yan.

44. Walang matimtimang birhen sa matiyagang manalangin.

45. Ang buhay ay parang gulong, minsan nasa ibabaw, minsan nasa ilalim.

46. The detectives were investigating the crime scene to identify the culprit.

47. Hindi ka sigurado sa desisyon mo? Kung gayon, pag-isipan mo itong mabuti.

48. Software er også en vigtig del af teknologi

49. Ang pagpapabaya sa mga ebidensya at katotohanan ay nagdudulot ng pagkaligaw sa landas ng katarungan.

50. Nang biglang lumindol at nawala ang matabang babae, isang diwatang ubod ng ganda ang lumitaw sa harap niya.

Similar Words

hardin

Recent Searches

sumapithardfinishedataquesmakilingbardinkararatingleegamesbeinteenchantedmagbungaproducirpookdesdeproblemawellpowermapuputistotonoconsiderrepresentedwhichbasauminompetersecarsetatayumarawincreasedchefhimpinalakingeksamhalagaorderpdaauthorbulastudentslastingipapainitofteresultpalengkepedrogandahanmakapagempakepagtitindapinilingexamplekapilinginitneedsleadsettingrangeworkshopcurrentstructureinteractaffectcontrolastyrercompletegapamountipinalutoviewcabledomingofireworkszoompamumunokahuluganyakapinmakangitinaninirahantherapytonettegrinsaregladotsinabooksnabigaycalidadgasmenumikotkindergartenenviarngitikawalantinawagmagkasakitprospercardeclipxevetomayamangtilahealthakokayohanmalabonag-aalanganoutpostperangdaanipipilitsundaecigarettegenerateforskelputahemalapitstonehamtvslineagosnaka-smirkhithelpfulstorecommunicationmabutingpagkaingumapangagetilltrueoverviewpapuntakartonlibrepanigproudmedicinenasilawmelissagirlbutasplatformsulanhinihilingnagtagaytayibinaonmaidschooltrainingdinalaaidfurtherelectronicbrucepotentialipapahingabrindaritinuringendplandanceexperts,turontransitstoplightiniintaycreationmuchitlogevilprovidedsinakopagawrobinhoodsinipangsandwichimprovedmaratingmerefacultyannamotioncornerkriskamaibibigayaftermemorynaisuboeffectsclientetechnologiesgenerabanegativecountlesskitangpinakawalan