Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

21 sentences found for "him"

1. Bagaimana mungkin dia bisa memperoleh nilai yang tinggi dalam ujian? (How is it possible for him to get such a high score in the exam?)

2. Green Lantern wields a power ring that allows him to create energy constructs based on his imagination.

3. He thought he was getting a free vacation, but I reminded him that there's no such thing as a free lunch.

4. He was already feeling embarrassed, and then his friends started laughing at him. That added insult to injury.

5. He was also known for his charismatic stage presence and unique vocal style, which helped to establish him as one of the most iconic figures in American music

6. In 1905, Einstein published a series of papers that established the foundations of modern physics and earned him worldwide recognition.

7. Jeg har været forelsket i ham i lang tid. (I've been in love with him for a long time.)

8. Jeg kan ikke stoppe med at tænke på ham. Jeg er virkelig forelsket. (I can't stop thinking about him. I'm really in love.)

9. Jeg tror, jeg er ved at blive forelsket i ham. (I think I'm starting to fall in love with him.)

10. May gusto lang akong malaman.. I have to ask him.

11. My dog hates going outside in the rain, and I don't blame him - it's really coming down like it's raining cats and dogs.

12. Nakahug lang siya sa akin, I can feel him..

13. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

14. The doctor advised him to get plenty of rest and fluids to recover from pneumonia.

15. The doctor advised him to monitor his blood pressure regularly and make changes to his lifestyle to manage high blood pressure.

16. The doctor measured his blood pressure and diagnosed him with high blood pressure.

17. The Flash can move at superhuman speed, making him the fastest man alive.

18. The momentum of the athlete propelled him across the finish line.

19. The player who has the ball is called the "offensive player," and the player guarding him is called the "defensive player."

20. The restaurant messed up his order, and then the waiter spilled a drink on him. That added insult to injury.

21. Tinaas ko yung isang kilay ko, I'm working for him noh.

Random Sentences

1. Binibigyang halaga ng mga Pilipino ang talambuhay ni Dr. Jose Rizal bilang isang pambansang bayani.

2. En mi jardín, cultivo varias hierbas como el tomillo, la albahaca y el perejil.

3. En ren samvittighed kan give os en følelse af ro og tilfredshed.

4. Sa tuwing mag-iisa ako, naiisip ko ang aking mga kaulayaw na nasa aking tabi.

5. Det er en dejlig følelse at være forelsket. (It's a wonderful feeling to be in love.)

6. At blive kvinde kræver også mod og selvstændighed.

7. All is fair in love and war.

8. Ang tag-ulan ay isa sa mga panahon ng taon na nagdadala ng malakas na pag-ulan at kadalasang nagdudulot ng baha at landslides.

9.

10. Hockey is known for its physicality, with players often engaging in body checks and other forms of contact during the game.

11. Hinugot niya ang kanyang puhunan sa bangko upang magtayo ng negosyo.

12. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

13. Di nagtagal, muli niyang naramdaman na tila nangangalirang na naman ang kanyang balat.

14. Habang nagbabaga ang araw ay isinakripisyo ng misyunero ang abang buhay.

15. Tanging ina lang at kapatid niya ang kanyang kasama

16. Ipapautang niya ang lahat ng pagkain at damit na bultu-bultong nakaimbak sa kanyang lalo pang pinalaking bodega.

17. Ang mga magsasaka sa kanayunan ay nag-aapuhap ng suporta mula sa gobyerno para sa kanilang mga pananim.

18. Nació en Caprese, Italia, en 1475.

19. Dahil sa sobrang init, naglipana ang mga puting ulap sa kalangitan.

20. Scientific research has shown that regular exercise can improve heart health.

21. Nagtatanong ako sa kanya kung ano ang mga gusto niya upang masiguro na magugustuhan niya ang aking mga regalo.

22. Sama-sama. - You're welcome.

23. I have been taking care of my sick friend for a week.

24. Parang ganun na nga babes. Tapos tumawa kami.

25. Hindi nga ba't meron din daw siyang mga pakpak tulad nila.

26. Hindi na maawat ang panaghoy ng matanda nang makita ang nasirang bahay.

27. Anong ginagawa mo?! mataray pang sabi nito.

28. Napagod siya dahil magdamagan ang trabaho.

29. Pupunta ako sa opisina ko sa Makati.

30. Sarado ang eskuwela sa Sabado at Linggo.

31. Raja Ampat di Papua Barat adalah tempat wisata yang indah dengan banyak pulau-pulau kecil, terumbu karang, dan satwa liar.

32. Ang calcium ay kailangan ng ating katawan upang tumibay pa ang buto.

33. Bago niya napanalunan ang ginto, si Hidilyn Diaz ay nagwagi na ng pilak na medalya sa Rio Olympics 2016.

34. In the years following his death, Presley's legacy has continued to grow

35. Naglalaway ako sa tuwing nakakakita ako ng masarap na kakanin.

36. En invierno, la nieve puede causar problemas en el transporte, como retrasos en vuelos y cierres de carreteras.

37. Nangahas ang binata na sumagot ng pabalang sa kanyang ama.

38. Kami ay pabalik na diyan sa kaharian, pasensiya na sa masamang balita.

39. Paano daw siya natalo ng isang matanda na mahina na ang mata at uugod-ugod pa.

40. Ailments can be managed through self-care practices, such as meditation or physical therapy.

41. Drømme kan være små eller store, men alle er vigtige.

42. Kasi ho, maraming dapat kumpunihin sa bahay.

43. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

44. Dansk øl og spiritus eksporteres til mange lande rundt omkring i verden.

45. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

46. Mahilig akong kumanta ng mga awiting gawa ng Bukas Palad.

47. Sige maghahanda na ako ng pagkain.

48. Sa pamamagitan ng pagkuha ng mahusay na tulog, ang aking pagkapagod ay napawi at nagkaroon ako ng sariwang enerhiya.

49. Abraham Lincoln, the sixteenth president of the United States, served from 1861 to 1865 and led the country through the Civil War, ultimately preserving the Union and ending slavery.

50. Ang labi niya ay isang dipang kapal.

Similar Words

Taga-HiroshimatahimikpanghimagasHinimas-himasNanahimikManahimiklihimhimayintumahimikhimutokilihimhimighimihiyawhimself

Recent Searches

himartificialviewsresponsiblelayunintomvasquesthereforethroughoutspeedtripagosmalimitminutepasanghalllabingsoonanimobabaespeechesreducedknowskanilamaratingextraenvironmentcontinuedhapdicommunicateinfluenceechaveprogresssteermakapilingsourcedumilatformspaki-bukasvisualmaliksiwaitwindowpublisheddumaramifutureclienteinfinitytaongsagotremembercurrentpatuyosamakatuwidnagtalunantinatawagpagkatakotnagkasakitbirdseveryamountmenosiginitgitmagpa-ospitalmarketplacessasamahanmagawapamanhikannaglahohubadkauntimadridnasunogmadalingisubopabalangbeforegamitkayaklimatignanlagaslasguronapakagandanggawabinuksantangingpagpapasanhiwagamagkapatiddapit-haponeyajingjingnamuhaygumuhittemparaturapatientkamalianpersonsandreatag-arawmanakboabrilboholnasasakupanpinagbigyanbilanggoallowingagadchecksmeetfistscruztutungopagongminatamissumalakaynalugodmagpagupitkatutubonapatungokuripotpambatangbrancher,pansamantalanakahigangkaraokenaapektuhanrevolucionadopagka-diwataunopare-parehopaga-alalatravelernagwo-workmagkakaanakmanahimiknabighanikubyertosnakatalungkoanywherejuanaaktibistabilibnatakotsenateplasanothingbakainatakekasiyahangmisteryomakulitothersnewgayafascinatingnakamittanghalinatulogracialnawalalayawkapatidhinognagdiriwangburmasedentarypalancaself-defenseataquesatacommunicationactingimprovementincreasinglyendprovekerbpotentialkadalasnahintakutanmadepagpapakilalapinagtatalunanpresidentetiyakcesinisipfarnakatagoalaalasigaltonapatingalatillattractivetaratugonnatabunan