Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

9 sentences found for "story"

1. Elvis Presley's life and career are a fascinating story of a young man who rose from humble beginnings to become one of the biggest stars in the world

2. Hendes historie er virkelig fascinerende. (Her story is really fascinating.)

3. I've found that sharing a personal story is a great way to break the ice and create a connection with others.

4. Jack and the Beanstalk tells the story of a young boy who trades his cow for magic beans.

5. Make a long story short

6. Snow White is a story about a princess who takes refuge in a cottage with seven dwarfs after her stepmother tries to harm her.

7. The legend of Santa Claus, a beloved figure associated with Christmas, evolved from the story of Saint Nicholas, a Christian bishop known for his generosity and kindness.

8. The Ugly Duckling is a story about a little bird who doesn't fit in until he discovers he's actually a beautiful swan.

9. The Velveteen Rabbit is a heartwarming story about a stuffed toy who becomes real through the love of a child.

Random Sentences

1. Hockey can be a physically demanding and challenging sport, but it can also be a lot of fun and a great way to stay active.

2. Sa anong tela yari ang pantalon?

3. Coffee can be prepared in a variety of ways, including drip brewing, espresso, and French press.

4. J'ai perdu mes clés quelque part dans la maison.

5. Nakalimutan ko na biglaang may appointment ako kanina kaya hindi ako nakapunta.

6. Ang bata ay takot na nakatingin sa kanya.

7. Maganda ang website na ginawa ni Michael.

8. Bayaan mo na nga sila.

9. The concept of God has also been used to justify social and political structures, with some societies claiming divine authority for their rulers or laws.

10. Ang pag-asa ay nagbibigay ng mga oportunidad para sa mga tao upang maabot ang kanilang mga pangarap at mga layunin sa buhay.

11. Si Juan ay nagiigib ng tubig mula sa poso para sa mga halaman sa hardin.

12. En boca cerrada no entran moscas. - Silence is golden.

13. Twitter often serves as a platform for influencers, activists, and celebrities to share their thoughts and engage with their audience.

14. Today, Amazon is one of the world's largest online retailers.

15. Kukuha na ako ng lisensya upang makapagmaneho na ako.

16. Mahilig kang magbasa? Kung gayon, baka magustuhan mo ang bagong librong ito.

17. El tiempo todo lo cura.

18. He listens to music while jogging.

19. Mahalagang magkaroon ng emergency fund upang maiwasan ang pagkakaroon ng utang sa panahon ng krisis o emergency.

20. A wedding is a ceremony in which two people are united in marriage.

21. Ang aking ina ay isang magaling na mang-aawit.

22. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

23. Ano ho ang ginawa ng dalawang babae?

24. Nasarapan siya kaya nag-uwi pa para sa mga kababayan.

25. The culprit behind the hit-and-run accident was later caught and charged with vehicular manslaughter.

26. Iyong pakakatandaan na ikaw lamang ang aking iniibig.

27. Nasira ang kanyang sasakyan dahil sa isang aksidente sa kalsada.

28. La poesía de Whitman tiene una belleza sublime que transmite su amor por la naturaleza.

29. Einstein's scientific work was heavily influenced by his philosophical and moral beliefs.

30. Sino ang iniligtas ng batang babae?

31. Bien que le jeu en ligne puisse être pratique, il est également important de prendre en compte les risques impliqués, tels que la fraude et le vol d'identité.

32. The project was behind schedule, and therefore extra resources were allocated.

33. The most famous professional hockey league is the NHL (National Hockey League), which is based in the United States and Canada.

34. Hindi maganda na maging sobrang mapanghinala sa lahat ng tao dahil sa agam-agam.

35. Anong ginawa nya sayo? Sya ba nagpaiyak sayo?

36. Ayan sasamahan ka na daw ni Kenji.

37. Coping strategies such as deep breathing, meditation, or exercise can help manage feelings of frustration.

38. Påsken er en tid, hvor mange mennesker giver til velgørende formål og tænker på andre, der har brug for hjælp.

39. En Argentina, el Día de San Valentín se celebra en el mes de julio.

40. Time management skills are important for balancing work responsibilities and personal life.

41. Ang mga kawal nagsisilbi sa bayan upang protektahan ang mamamayan.

42. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

43. Hmmmm! pag-iinat ko as soon as magising ako. Huh?

44. Ang umuulan nang malakas ay binulabog ang mga kalsada at nagdulot ng matinding baha.

45. Los agricultores merecen ser valorados y respetados por su trabajo duro y su contribución a la sociedad.

46. Marahil ay hindi pa ito ang tamang panahon upang magpakasal.

47. Limitations can be physical, mental, emotional, financial, or social.

48. Ahh nasa shower kasi si Maico sinagot ko na baka impor...

49. Maraming tao ang nagpaplastikan sa harap ng ibang tao para lang mapasama.

50. En invierno, los días son más cortos y las noches son más largas.

Similar Words

history

Recent Searches

kommunikererjingjingpakikipaglabanstorypoongtenniskawalbiyayangculturespagbabantacruzpagbibirolansangannagsilapitmasaganangnaglaonnahigitanbakantekatolisismonakapagproposehigantedadalawbihasagatashirambilihintindahanhinalungkatattorneysaktaniyamotpagdiriwangreorganizingnagwalisbayadsementonginiirogpagka-diwataumupobibilibumagsakcandidatesmoneyiniangatwastesocietykakayananibilisakyanininomhanapinfavorlakaduwakmaisipiniintayisamanasanbalangwidelymatayogguidanceiyaknagdaosmaghintaydadaloanilahusomenosadversepierultimatelypakainkabosesingatantiketpaghingiipantalopdahaninterestsnakasuottemperaturapagtangisresultpaslithoweverpreviouslyinisbelievedbuspitakaprobablementemesangmaliniswalangmajorproblemaincreasestipfirstclientescorrectingnariningregularmenteandrefallabringdinggininilingplanitlogcoachingformswaithategeneratedcreatecomputermakapilinghighestmonitortabastructureevolvetwowindowerhvervslivetsasambulatnaantigsakristanmahahanaysisentasiyangbawatdiliginnasasakupannakapilanagtatanimmatangumpayawitinturonsisipainprosesogigisingsnalamannaginghardingumapangclasesreservessasagotproyektoverymemoryuugud-ugodniyonitinindighulihanrobinphilanthropypaghangamanahimikalapaapdavaoumiibignaabotvisualaposundaeagosbansangbingopasswordmurangcountlessgapkagubatanbroadnaroonnagtungomahagwaysearchnakaka-inbukasnegosyantemagpasalamatkwelyonakapikitbarcelonabagohangaringbinatilyomatitigaslumilipadnakalipasmakapalagnatigilanmahiwagangkarami