Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

4 sentences found for "surgery"

1. Ailments can be treated through medication, therapy, surgery, or other medical interventions.

2. Cancer can be treated through a variety of methods, including surgery, chemotherapy, radiation therapy, and immunotherapy.

3. Medical technology has also advanced in the areas of surgery and therapeutics, such as in robotic surgery and gene therapy

4. Patients may be hospitalized for a variety of reasons, including surgery, illness, injury, or chronic conditions.

Random Sentences

1. Madalas syang sumali sa poster making contest.

2. Namiss kita eh. Sabay ngiti ko sa kanya.

3. My husband surprised me with a trip for my birthday, and I couldn't be happier.

4. This house is for sale.

5. Pull yourself together and focus on the task at hand.

6. Sa mga himig ng kundiman, nadarama ang tibok ng puso at pagkakaisa ng mga Pilipino.

7. Han er den eneste, jeg nogensinde har været forelsket i. (He's the only one I've ever been in love with.)

8. Additionally, it has greatly improved emergency services, allowing people to call for help in case of an emergency

9. Naging espesyal ang gabi ng pamamamanhikan dahil sa pagtutulungan ng dalawang pamilya para sa nalalapit na kasal.

10. Grabe ang lamig pala sa Japan.

11. Les travailleurs doivent souvent se soumettre à une évaluation annuelle de leur performance.

12. Kings have held power throughout human history, from ancient civilizations to modern times.

13. Kelahiran di Indonesia biasanya dianggap sebagai momen yang sangat penting dan bahagia.

14. Kapag aking sabihing minamahal kita.

15. Einstein's work led to the development of technologies such as nuclear power and GPS.

16. Galing sa brainly ang isinagot ko sa asignatura.

17. Reducing water consumption and using water-efficient technologies can help protect freshwater resources.

18. Ang lakas mo uminom wala ka naman ambag.

19. Hindi siya makapaniwala kaya sinalat niya ang kanyang mukha.

20. Maganda ang kulay ng mga puno sa panahon

21. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

22. La obra de Leonardo da Vinci es considerada una de las más importantes del Renacimiento.

23. Jagiya? hinde parin siya umiimik, Ya Kenji.

24. Omelettes are a popular choice for those following a low-carb or high-protein diet.

25. Ang pag-uusap namin ng aking kasintahan ay nagpawi ng aming hindi pagkakaunawaan at nagbigay-daan sa pagkakasunduan.

26. Las personas pobres a menudo viven en condiciones precarias y carecen de seguridad económica.

27. Nag hiking kami sa Mt. Makiling.

28. Nahahalinhan ng takot at lungkot nang kumulog at kumidlat.

29. Habang nakaluhod, dalawang kamay niyang tinutop ang pisngi.

30. Nagre-review sila para sa eksam.

31. Tengo dolor de garganta. (I have a sore throat.)

32. I just got around to watching that movie - better late than never.

33. He was one of the first musicians to popularize rock and roll, and his music and style helped to break down racial barriers and bring different cultures together

34. I am absolutely determined to achieve my goals.

35. Hanggang mahulog ang tala.

36. Amazon Web Services (AWS) is a popular cloud computing platform used by businesses and developers.

37. The team's colors are purple and gold, and they play their home games at the Staples Center.

38. La música puede ser utilizada como terapia para mejorar la salud mental y emocional.

39. Facebook Events feature allows users to create, share, and RSVP to events.

40. 'Di ko ipipilit sa 'yo.

41. Hospitalization can range from a few hours to several days or weeks, depending on the nature and severity of the condition.

42. Inakalang magaling na siya sa sakit, pero bumalik ang mga sintomas.

43. Napuno ako ng lungkot at naglabas ng malalim na himutok sa harap ng aking mga kaibigan.

44. Sa Chinese New Year, ang mga tao ay nagbabasbasan at nagpapalakas ng kanilang mga panalangin para sa magandang kapalaran.

45. Siya ang aking kaulayaw sa lahat ng bagay.

46. Naghanda sila para sa kasal na gagawin sa bundok.

47. Platforms like Upwork and Fiverr make it easy to find clients and get paid for your work

48. I am not watching TV at the moment.

49. Smoking can be addictive due to the nicotine content in tobacco products.

50. Masayang nakihalubilo si Paniki sa mga mababangis na hayop.

Recent Searches

surgerysidonanghahapdinanghihinamadnakapamintanamakapangyarihanmaipantawid-gutomnakikini-kinitapalipat-lipatnagtatanongsikre,albularyokasangkapanmagpaliwanagpulang-pulanapakatalinonagbakasyonnamulatobra-maestramakikipag-duetobumibitiwnalakinakakarinigkumaliwanakasandignahihiyangnapakamotnaibibigaydumagundongmagbabagsiksasagutinbinibiyayaanpakanta-kantangsystemprocessmakauwinapakagandakilongsumusulatnakikitangistasyonpaghahabinakahugpawiinarbejdsstyrkegovernmenttangekshayaangmagsungitdiyaryoregulering,franciscovidtstrakthinihintaymamahalinnakilalamaintindihanibinigaytumalonisinuotkinalakihandurantemagbabalakarapatangsusunodguerreroincitamenternaiiritangmaghihintaykulturnaglutopagbibirotelecomunicacionesorkidyashinahaplosnanigaspauwiunosbiglaanhihigitmakalingpesopinisilpagsidlanmaranasanpaakyatmaskineritonagkitakadaratingnaiwangmabutiasiabisikletakatolikokaraniwangpakaininbumagsakipinangangaksikatbibilinatutuwaawitinqualitypamamahingamayamangkumbentobinanggalalakelalongwaiternapapikitbestidaexpeditedpulitikogymkamatisvetokinainpanindangbalangutilizarnaglabananpamimilhingkarangalanwastecapacidadkungaccederterminocontestnamdilimbienespigasbitiwanpeacelutoilogbeganradioventatienemayroonmaarilandomournedkapenapatingalabinilhaniniinomdangerousiilanhopepasalamatanmemberspinilitnakapasokpagkaingmalapitspaayudadeathsoonbipolarhan1973tvswowibalikofficepagepasinghalayansummitapppilingstopdebatessquatterbehalfmaputistagecandidateinilingsyncerrors,makapilingstringnapilingyeahstructureipinaliteditorthirddoingmagsunognagtalagahonanito