Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "infinity"

1. To infinity and beyond! at binaba ko ulit yung telepono.

Random Sentences

1. Ang hindi marunong tumingin sa pinanggalingan, hindi makakarating sa paroroonan.

2. She does not skip her exercise routine.

3. Les algorithmes d'intelligence artificielle peuvent être utilisés pour prédire les tendances du marché et ajuster les stratégies commerciales en conséquence.

4. Naging tradisyon na sa kanilang baryo ang pagdiriwang ng kaarawan ng kanilang santo.

5. Ano ba problema mo? Bakit ba ayaw mong magpa-ospital?!

6. Fleksibilitetstræning, såsom yoga og strækning, kan hjælpe med at forbedre bevægeligheden og reducere risikoen for skader.

7. Les personnes ayant une faible estime de soi peuvent avoir du mal à se motiver, car elles peuvent ne pas croire en leur capacité à réussir.

8. Binansagang "Gymnastics Prodigy" si Carlos Yulo dahil sa kanyang talento at husay.

9. The Lakers have won a total of 17 NBA championships, making them tied with the Boston Celtics for the most championships in NBA history.

10. Sometimes it is necessary to let go of unrealistic expectations or goals in order to alleviate frustration.

11. In the early days, telephones were connected to a central switchboard, which connected calls manually

12. Kapag may isinuksok, may madudukot.

13. Menghargai dan mensyukuri apa yang kita miliki saat ini merupakan kunci untuk mencapai kebahagiaan.

14. Walang konsyerto sa plasa mamayang gabi.

15. Mag-iikasiyam na nang dumating siya sa pamilihan.

16. Anak natin. nakangiti pang sabi niya.

17. Magtatampo na ako niyan. seryosong sabi niya.

18. Sambal adalah saus pedas yang terbuat dari cabai dan bumbu-bumbu lainnya.

19. The game is played with two teams of five players each.

20. Emphasis is an important component of artistic expression, such as in poetry and music.

21. Palibhasa ay madalas na mas matalino kaysa sa ibang mga tao sa kanyang paligid.

22. Ano ang gagawin ni Trina sa Oktubre?

23. El uso de las redes sociales está en constante aumento.

24. Holy Week culminates in the celebration of Easter Sunday, when Christians gather to commemorate the resurrection of Jesus and the triumph of life over death.

25. Tinanong niya ang mga kapitbahay kung nakita nila ang kanyang anak.

26. Maria, si Ginang Cruz. Guro ko siya.

27. Puwede ba akong sumakay ng dyipni?

28. Patients may experience pain, discomfort, and anxiety during their hospital stay.

29. Mahalaga rin ang pagkakaroon ng kooperasyon at pagtutulungan upang malutas ang mga palaisipan sa isang grupo o komunidad.

30. Natapos mo na ang proyekto mo? Kung gayon, maaari ka nang magpahinga.

31. Hockey games are typically divided into three periods of 20 minutes each, with a short break between each period.

32. Sa kanyang paglalakad, napadungaw siya sa isang tindahan ng kakanin at napabili ng puto.

33. The Supreme Court is the highest court in the land and has the power of judicial review, meaning it can declare laws unconstitutional

34. Ang aming pamilya ay nagpapahalaga sa konsepto ng bayanihan at palaging handang tumulong sa kapwa.

35. Twinkle, twinkle, little star.

36. Sang-ayon ako na importante ang pagpapahalaga sa ating kultura at tradisyon.

37. Points are scored when the ball goes through the basket, and the team with the most points at the end of the game wins.

38. Bukod tanging ang buto ng kasoy ang lungkut na lungkot.

39. Millard Fillmore, the thirteenth president of the United States, served from 1850 to 1853 and signed the Compromise of 1850, which helped to delay the outbreak of the Civil War.

40. Makikita mo sa google ang sagot.

41. He has numerous endorsement deals and business ventures, including his own media production company, SpringHill Entertainment.

42. Walang nakakaalam kung saan sila napupunta.

43. Ngunit parang walang puso ang higante.

44. ¿Te gusta el sabor picante del jengibre?

45. Omelettes can be made using egg whites only for a healthier, lower-fat option.

46. Walang nakapakinig sa panaghoy ng matandang naglalakad sa lansangan.

47. Hansel and Gretel find themselves lost in the woods and stumble upon a gingerbread house owned by a wicked witch.

48. Air susu dibalas air tuba.

49. A penny saved is a penny earned.

50. El primer teléfono consistía en un micrófono y un receptor, conectados por un cable

Recent Searches

ayancreatinginterviewinginfinitynangyarimakatulogpagkainisnakabawiumiinomcancermagkamalicultureutak-biyapagpanhiknaiyakh-hoykadalagahangmagkapatidflyvemaskinerpagmamanehoadvertising,nagtitiiswalkie-talkienakakadalawkasawiang-paladnagsisipag-uwianlaki-lakikategori,mangingisdamungkahisiniyasatnakayukokumaliwatagtuyothinimas-himasmaliksipagkabuhaytatawaganpanghihiyangmasasabierhvervslivetnagsasagoteskwelahandisenyongnatatawapagngitifysik,miyerkulesmauupoumiimikkuwentorektanggulotahanansalbahenglalabhannasasalinanprimerosmaibamusicalvaledictorianmatutulognabigayna-curiouspigilanumokaylalargagelaikasamaangpinabulaanpantalonnewssakopnapakamasukoltransporttelephoneiikotrimasunconventionalgatolpanunuksoakmanghinugotsasapakinunconstitutionalkagubatanmeronlipadjocelynaffiliatewastepangalanrenatopsssmatigasdasalmataraymulighedermakulitbrasomalambingpabalangtarcilaosakapakealamairconangkankinainbiliboholcharismaticvistrestaurantdahilinihandaibigramdamloans1000panaybuslopopularizefuelproductionsiemprecellphonedalawapaticineipapaputolnakapagsalitaerapdisappointmoodtryghedreaderssumabogbumahamaitimnuondiamondbangfuedollybagyogrewgumisingmag-ibaumigibpookbalesinongginisingpakpakadverselynewbilismalinisknow-howmeethumanotherapymarchsusunduintextodumatingunodinifindbilergamescommunicationscharmingpaainalalayanitinalicadenaagoshandingdingnotebookregularmenteoffentligventabinabafiguretiposbreakmapapapossiblepersonsplatforms4thinterpretingtuwatuwidna-suwaypronountutusindrew