Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "available"

1. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

2. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

3. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

4. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

5. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

6. The beach has a variety of water sports available, from surfing to kayaking.

7. The clothing store has a variety of styles available, from casual to formal.

8. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

9. The store has a variety of sizes available, from small to extra-large.

10. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

Random Sentences

1. Ang paggamit ng droga ay nagpapakita lamang ng kahinaan sa tao.

2. Sa pamamagitan ng pag-aaral ng kasaysayan, mas naging malalim ang aking kamalayan sa mga pangyayari noong panahon ng Digmaang Pandaigdig II.

3. Las escuelas pueden ofrecer programas de intercambio estudiantil para estudiantes internacionales.

4. Naglakad ang bata papuntang eskuwelahan.

5. My sister gave me a thoughtful birthday card.

6. Es importante tener en cuenta que el clima y el suelo son factores importantes a considerar en el proceso de cultivo del maíz

7. Nag-aalinlangan ako sa aking desisyon dahil sa aking mga agam-agam tungkol sa magiging epekto nito sa aking pamilya.

8. Igigiit nito na ang matanda ay nandaya at baka ipinalit lamang ang isang nagawa nang tela sa ginagawa nito.

9. Pakibigay na lang sa kanya ang sukli para hindi na siya bumalik pa.

10. If you're trying to get me to change my mind, you're barking up the wrong tree.

11. Isa sa paborito kong kanta ng Bukas Palad ay "I Will Sing Forever".

12. Confocal microscopes use laser technology to create 3D images of small structures.

13. Nagtaas na nang pamasahe ang trycycle.

14. Sa eroplano, hinde ko mapilitang hinde malungkot.

15. Sa kanyang bakasyon, nagpasya siyang lumibot sa iba't ibang tourist spots ng bansa.

16. Inakalang magtatagal ang kanilang relasyon, pero naghiwalay din sila.

17. At minamadali kong himayin itong bulak.

18. Andre helte er kendt for deres humanitære arbejde.

19. Hospitalization can provide valuable data for medical research and innovation, leading to improved treatments and outcomes for future patients.

20. Les patients peuvent être hospitalisés pour une durée variable en fonction de leur état de santé.

21. Omelettes are a popular choice for those following a low-carb or high-protein diet.

22. The Lakers have had periods of dominance, including the "Showtime" era in the 1980s, when they were known for their fast-paced and entertaining style of play.

23. Sino ang puwede sa Lunes ng gabi?

24. I nogle dele af Danmark er det traditionelt at spise påskelam til påskefrokosten.

25. Psss. napatignin ako kay Maico. Naka-smirk siya.

26. Wala yun. Di ko nga naisip na makakatulong. aniya.

27. We were trying to keep the details of our business plan under wraps, but one of our investors let the cat out of the bag to our competitors.

28. Sa takipsilim kami nagsimulang mag-akyat ng bundok.

29. Inakala nga noon ng mga magulang na hindi na magkakaanak dahil matanda na ang kanyang ina pero isinilang parin siya.

30. We have been waiting for the train for an hour.

31. Dahil sa kanyang pagka-suway, si Carla ay napag-initan ng kapwa niya empleyado.

32. Ang buntot ng saranggola ay mahaba at makulay.

33. Elektronisk udstyr kan hjælpe med at automatisere opgaver og reducere fejl.

34. Cooking at home with fresh ingredients is an easy way to eat more healthily.

35. The momentum of the rocket propelled it into space.

36. Kailangan nating magpasya ng may katwiran at hustisya, datapapwat ay hindi palaging tama ang ating mga desisyon.

37. Oh Aya, napatawag ka? mejo bagsak ang boses ko.

38. The Lakers have a strong social media presence and engage with fans through various platforms, keeping them connected and involved.

39. Naghahanap ako ng mga chord ng kanta ng Bukas Palad sa internet.

40. Nang tumunog ang alarma, kumaripas ng takbo ang mga tao palabas ng gusali.

41. She has completed her PhD.

42. "A dog's love is unconditional."

43. Alam ko pede kang mapagkatiwalaan, Peppy. Kaya please?

44. I've got a big presentation at work today - I hope I don't break a leg!

45. He began his musical career in the early 1950s, and quickly became one of the most popular and influential musicians of his time

46. Alay ko sa iyo ang bawat sandali ng buhay ko.

47. Ang hudyat ay maaaring maging simpleng galaw o kilos, o maaaring isinasaad sa pamamagitan ng komplikadong simbolo o wika.

48. Ito ba ang papunta sa simbahan?

49. Mahigpit namang ikinabit ng mga halaman ang mga ugat sa ilalim ng lupa.

50. Her perfume line, including fragrances like "Cloud" and "Thank U, Next," has been highly successful.

Recent Searches

moodavailableiikotderpopularizepagguhitmay-aripatrickcadenangpuntapaghingimulahojaskuwintastelefonerchunpumatolnuhfakesyncpaki-bukasnagdarasalandrebreakibonbiggestkinikilalangadvancehomeworkknowledgetrycycleautomaticlumilipadmataaasinfluencesmilyongmurangmahalaganagpapaypaybilispaligidbodaoposelleskuwelahanmadulasmusmosnobelaisusuotpaghanga1950snagsusulatumiibigpinagwagihangtumatawadHabangpasswordsalahotdogsagotbusloulongpangungutyacountlessnagtatrabahooxygenresponsiblekaparusahanrelysaranggolacosechasbrightsantokapataganminahannagmukabarriersmahiwagangdumilatyourkahongde-dekorasyonmatabangumakbaymaubostresipagbilinyemedikalsumalivedisinamamaghilamosditosangavehiclesisinuottradisyonpakikipagtagpoadvertising,boyfriendhihigitkurbatadatapwatskillssettingvitamintinataluntonmadamikagandahanlever,throatkinapanayamnakapagngangalitkwartonakakatulongpisngitoothbrushnabalitaancitizenswaiternakabaonmatandangpalasyokasuutannamatayraisemaibigaydumarayomaiskunenovellessundalohetokaaya-ayangnapakabilisbubongasthmatanimtamaprosesohahatolbilihinkadaratingfranciscotodayspeedhawakorganizenag-iimbitayuntulunganpalayokabibistoremakikiligokumalmaevenbinawiaregladopadrepagsayadcardmakapagsabimaglabalookedunattendedsaktansabogdidinggarbansosgraphicnangangaralumangatmakessamukayongso-calledmanahimikprimernagreplystrategiessubalitinitgrinsparehinanakitvankaninangupuanunosnakatawagsicabakurankapaintumalimbahatagalogincreases