Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

10 sentences found for "available"

1. Decaffeinated coffee is also available for those who prefer to avoid caffeine.

2. Electric cars are available in a variety of models and price ranges to suit different budgets and needs.

3. Over the years, television technology has evolved and improved, and today, there are a variety of different types of television sets available, including LCD, LED, and plasma TVs

4. Smoking cessation programs and resources are available to help individuals quit smoking, such as nicotine replacement therapy and counseling.

5. Support groups and resources are available to help patients and families cope with the challenges of leukemia.

6. The beach has a variety of water sports available, from surfing to kayaking.

7. The clothing store has a variety of styles available, from casual to formal.

8. The coffee shop has a variety of blends and flavors available, from dark roast to vanilla latte.

9. The store has a variety of sizes available, from small to extra-large.

10. Vaccines are available for some viruses, such as the flu and HPV, to help prevent infection.

Random Sentences

1. Makikita ko ang mga kapatid ko sa pasko.

2. Hindi ko ho makain dahil napakaalat.

3. Ang buhawi ay maaaring magdulot ng matinding pagkasira sa kagubatan at kapaligiran dahil sa malakas na hangin at pag-ulan.

4. Na-suway ang batang lalaki nang hindi umuwi sa oras na itinakda ng kanyang magulang.

5. Nasa Montreal ako tuwing Enero.

6. Sa kaibuturan ng kanyang kaluluwa, alam niyang tama ang kanyang mga desisyon.

7. Efter fødslen kan der være en følelse af lettelse og glæde over at have en ny baby.

8. Sang-ayon ako na kailangan nating magkaroon ng sapat na pondo para sa pagpapaunlad ng ating mga komunidad.

9. Ang pagpapahalaga sa mga kabuluhan ng buhay ay mas mahalaga kaysa sa mga kababawan ng mundo.

10. Ang ganda talaga nya para syang artista.

11. El atardecer en el mar es un momento sublime que muchos aprecian.

12. Ang panitikan ay may kakayahan na magbukas ng ating isipan sa iba't ibang kaisipan at ideya.

13. I'm not superstitious, but I always say "break a leg" to my friends before a big test or presentation.

14. Ang laman ay malasutla at matamis.

15. Pinayuhan siya ng doktor tungkol sa pangangalaga sa bungang-araw.

16. Naglalakad ako sa kalsada nang bigla akong napagod sa hatinggabi.

17. Ang aming angkan ay mayroong natatanging uri ng pagluluto.

18. At vedligeholde en regelmæssig træningsrutine kan være udfordrende, men belønningerne for ens sundhed og velvære kan være betydelige.

19. The United States has a diverse economy, with industries ranging from agriculture to finance to technology.

20. Businesses and brands utilize Instagram to promote products and services through visually appealing posts.

21. Have we completed the project on time?

22. Waring may kakaibang nararamdaman siya, ngunit hindi niya ito maipaliwanag.

23. Bumagsak ang dilim sa kalsada ng biglaan kaming tumama sa ilaw ng poste ng kuryente.

24. Las labradoras son perros muy fuertes y pueden soportar mucho esfuerzo físico.

25. Keep practicing and hang in there - you'll get better at it.

26. Pinagsulat si Jayson ng pangungusap sa pisara.

27. Thomas Jefferson, the third president of the United States, served from 1801 to 1809 and was the principal author of the Declaration of Independence.

28. Ailments can be a result of aging, and many older adults experience age-related ailments, such as arthritis or hearing loss.

29. Wag kana magselos, mahal naman kita eh.

30. Julia Roberts is an Academy Award-winning actress known for her roles in films like "Pretty Woman" and "Erin Brockovich."

31. Mens online gambling kan være bekvemt, er det også vigtigt at være opmærksom på de risici, der er involveret, såsom snyd og identitetstyveri.

32. El usuario hablaba en el micrófono, lo que generaba señales eléctricas que eran transmitidas por el cable hasta el receptor, donde eran convertidas de nuevo en sonido

33. Halos anim na oras silang naglakad paakyat ng bundok makiling.

34. Ang utang ay maaaring magdulot ng stress at anxiety kung hindi ito maayos na hinaharap.

35. Aaissh! biglang upo si Maico pagka-maktol.

36. Dahil sa pangyayaring ito, mas lalong natakot ang mga taong bayan na lumapit sa puno.

37. Kanina pa siya ganyan kuya.. parang ang lalim ng iniisip.

38. Ikinagagalak kong maglingkod sa inyo bilang inyong guro.

39. Ang purgatoryo ay nagpapakita ng kahalagahan ng paglilinis at pag-aayos ng kaluluwa bago pumasok sa langit.

40. Hindi siya sumagot sa tanong ko, waring may iniisip siyang iba.

41. Mas nagustuhan ko ang guro ko sa Musika kaysa sa dati kong guro.

42. They admire the way their boss manages the company with fairness and efficiency.

43. Tila hindi pa tapos ang laban, kaya’t kailangan pa nating maghanda.

44. Matutulog ako mamayang alas-dose.

45. Las redes sociales tienen un impacto en la forma en que las personas se comunican y relacionan.

46. Emphasis can be used to create rhythm and cadence in language.

47. Mining is the process of creating new units of cryptocurrency through complex algorithms and calculations.

48. Einstein's work led to the development of technologies such as nuclear power and GPS.

49. She speaks three languages fluently.

50. Hindi ko alam kung bakit hindi mo na gustong makipag-usap sa akin.

Recent Searches

availabletaladelegatedcoughingkababayanlordkumaripasnerissakindsnai-dialngisikatapatlandasmasayangcommercialmaisusuotopisinapakakasalanvampiresnahihilostatefeelnaupokumirotkakutist-ibangnamuhaynabiawangkumikinigpiyanosandalingusopamansuwailafterpambahaymakabawitumawahinatidmagsimulapagsalakayhinanaptig-bebentekasintahantaingadevelopedwalongsadyangiinuminochandonakalilipasbinangganapatinginbulakcampaignsnagta-trabahomestnaiiritanglikelydedication,mangegamesmagdaraostumikimkaragatanwidespreadduwendepapasokisinaboycorporationperopangambahapag-kainanmasayahinmawawalailalagaymabaitnaaliskamaymalulungkotreboundmasipagdomingopatongarabiasementoincrediblemanalotirangfreedomshinugotcleanbehalfdinalametodetiposstudentslcdchamberspasswordataquesbumabashifteffectsayokolikespasensyachickenpoxklasengmatapangsacrificelalakesumisilipwinsdumilimfrogdraft,neverfullboxsofaconditioningbringingseenataperaconcernsdinilateoutlinesroonjanemisaverypagpapakilalamoviesnaglalatangkaibigannakapangasawaganangnakaupovirksomheder,nagtatrabahonagpapakainnagtrabahomerlindanakumbinsibaranggaymagkakagustokumakalansinganibersaryosaranggolakonsentrasyonnakatalungkonapasigawbefolkningen,energy-coalsakristanmahahanaytatawagtuluyannapaluhatravelerfotosmagturonanaigpagkaangatsinaliksikpagkaraatumunogkalabawairportmakatulogpagtinginpinamalagimagtatakacompaniespaninigasisinagotnatabunankagubatanmaanghangkongresosiksikaninuulcernaiilangmaawaingkumantanobodyininomsusunodbinentahaniikutanpagbabantarodonaganitoalakmatipunopatienceimbes