Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "overview"

1. While there are concerns about the effects of television on society, the medium continues to evolve and improve, and it is likely to remain an important part of our daily lives for many years to come This is just a brief overview of the 1000 paragraphs about television, as the information provided would be too long to fit here

Random Sentences

1. That is why new and unconventional sources of energy like nuclear and solar energy need to be developed

2. Sí, claro, puedo confirmar tu reserva.

3. I thought about going for a run, but it's raining cats and dogs outside, so I'll just stay inside and read instead.

4. May mahalagang aral o mensahe na ipinakilala sa kabanata, naglalayong magbigay ng kahulugan at kabuluhan sa kwento.

5. Gusto ko pang mag-order ng kanin.

6. Eine hohe Inflation kann die Arbeitslosigkeit erhöhen.

7. Mi aspiración es hacer una diferencia positiva en la vida de las personas a través de mi trabajo. (My aspiration is to make a positive difference in people's lives through my work.)

8. Nakangiti sya habang nakatayo ako at nagtataka.

9. He's always the first one in the office because he believes in the early bird gets the worm.

10. Samang-palad, tamad ang binatilyong apo, ayaw tumulong sa lola at, araw-araw, bumababa sa baranggay upang makipag-barkada at magsugal.

11. Mi novio me sorprendió con un regalo muy romántico en el Día de los Enamorados.

12. I spotted a beautiful lady at the art gallery, and had to paint a portrait of her.

13. Me encanta pasar tiempo con mis amigos jugando al fútbol.

14. Spider-Man can crawl walls and has a "spider-sense" that alerts him to danger.

15. O sige na nga, diba magkababata kayo ni Lory?

16. Umokay ang result ng pagsusulit ni Jayson matapos itong magsunog ng kilay.

17. He is having a conversation with his friend.

18. Kinuha ko yung CP niya sa bedside table.

19. Nahuli ng guwardiya ang magnanakaw habang ini-inspect ang kanyang bag.

20. They offer rewards and cashback programs for using their credit card.

21. Ow, sorry nagising ata kita. aniya.

22. Bell's invention was based on the idea of using electrical signals to transmit sound, which was a new concept at the time

23. At være transkønnet kan være en svær og udfordrende rejse, da det kræver en dyb forståelse af ens identitet og en følelse af mod og autenticitet.

24. It was invented in England by the Scottish scientist J.N. Baird in 1928 and the British Broadcasting Corporation was the first to broadcast television images in 1929. Previously the radio helped us hear things from far and near.

25. Huwag magmadali, namnamin mo ang proseso ng pagkatuto.

26. Los agricultores pueden aprovechar la tecnología para mejorar sus prácticas y aumentar su producción.

27. But recently it has been detected that the habit of smoking causes different kinds of serious physical ailments, beginning with coughing, sore throat, laryngitis, and asthma, and ending with such a fatal disease as cancer

28. Sin agua, los seres vivos no podrían sobrevivir.

29. Det har også ændret måden, vi underholder os og håndterer vores daglige opgaver

30. Wag ka naman ganyan. Jacky---

31. Ang sugal ay isang hindi makabuluhang pamumuhunan na madalas nawawala ang ininveste.

32. The bride and groom usually exchange vows and make promises to each other during the ceremony.

33. Scientific research has shown that meditation can have a positive impact on mental health.

34. I have been swimming for an hour.

35. Inalagaan niyang mabuti ang halaman at tinawag itong Pinang, Sa palipat-lipat sa bibig ng mga tao ang pinang ay naging pinya.

36. Isang araw, may nakitang halaman si Aling Rosa sa kanyang bakuran.

37. Stay there. si Maico sa awtoritadong tono.

38. Effective representatives possess strong communication, leadership, and negotiation skills to effectively represent their constituents' interests.

39. Magkapareho ang kulay ng mga damit.

40. Kaninong payong ang asul na payong?

41. Hindi ko alam kung kakayanin ko, pero sana pwede ba kitang ligawan?

42. Ako ay may kaugnayan sa iyo sapagkat ako ang nagbiyaya sa iyong mga magulang upang ikaw ay isilang dahil sa kanilang busilak na kalooban.

43. Ang hindi magmahal sa sariling wika, ay higit pa sa hayop at malansang isda.

44. Sa kalayaan, nakakamit natin ang tunay na katarungan at pagkakapantay-pantay.

45. Microscopes are important tools for medical diagnosis and treatment, allowing doctors to examine cells and tissues for abnormalities.

46. I know we're behind schedule, but let's not cut corners on safety.

47. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

48. Ang tagumpay ng ating bayan sa larangan ng sports ay ikinagagalak ng buong bansa.

49. Wala ka namang dapat ipag-alala. Kaya ko ang sarili ko.

50. Sa Calamba, Laguna ipinanganak ang pambansang bayani na si Jose Rizal.

Recent Searches

overviewshapingconcernsspaghettibarpartnerfeelingcoachingprosperhatingo-onlineblessprotestamanyuminomfullhimlimitferrerlikelybakeinspiredreadconsiderincreaseskillcommunicatemerewebsitebasaextrahulinggeneratedstringhatepaceevolvedinitcontinuecompleteplatformspreadkangnapakagandarevolucionadonasasalinantalino3hrstanghalimakulitkulogmariangtuwingcinereadersschoolspaastorebagkus,downschoolcreateventanaglulusakmarkakineleksyonnagpakunotpatakbogodtnaglaonattorneybinabarathalakhaknagtrabahopagkakayakapressourcernerenombrepatutunguhanpag-aaralangsportsnakikilalangpagpapakilalasumuotbutchhmmmconsumepssssonidogabrieleclipxematapangmalikotautomationkategori,pagpapakalatmakikitakadalagahangpinagkaloobanmanghikayatdeliciosanag-angatpagkabuhaynapakagagandanalalabinakasahodkarunungantatawagnagkakasyafilmnapapahintolumakimahinakalakipangungusapmaisusuotgumagamitkabuntisankusineroairportnapasigawpublishedumigtadpictureskampeonapelyidosalbahengkaklasenakahaintenniskomedorapatnapumaipapautangnabasamanakbopakistaninaabotbulalastinuturokailanmanayospundidokumanannagsilapitpaulit-ulitasahanbibilitirangwakasbiyernesbumagsakpanginoonmatutuloghumihingipagpaliteroplanodreamsdustpanparoroonareynapulitikoannikainfusionestayotawanancandidatesallegrupolegendfe-facebooklayawmatigasracialpinatiraeneroimbesstreetkutodkasuutanlihimsolarwerepisoattractivehiramgraphichiningigrammaraudiencefauxpakilutosumangpostcardpopcornpakainpopularizepulubiarbejdersinapakmahahaba