Type the word and use it in a sentence

Supported Language(s):
Danish
German
English
Spanish
French
Indonesian
Tagalog

1 sentences found for "matang"

1. Sa pagkakatumba ni Aya, nanlilisik pa ang mga matang tumingin sa ama.

Random Sentences

1. Alles Gute! - All the best!

2. Ang laki ng wedding cake na ginawa ng kanyang ate.

3. Danske møbler er kendt for deres høje kvalitet og eksporteres til mange lande.

4. The stock market can be volatile and subject to fluctuations due to a variety of factors such as economic conditions, political events, and investor sentiment.

5. Dumating siya sa tindahan ng mga tuyong paninda at bumili ng isang kartong mantika.

6. Amazon's entry into the healthcare industry with its acquisition of PillPack has disrupted the traditional pharmacy industry.

7. Ayos lang ako. Ipapahinga ko lang ito.

8. Ano ang pangalan ng babaeng buntis?

9. Nagpamasahe ako sa Boracay Spa.

10. Ang pag-akyat ng presyo ng mga bilihin ay nagdulot ng masusing pag-aalala at ikinalulungkot ng maraming pamilya.

11. I don't usually go to the movies, but once in a blue moon, there's a film that I just have to see on the big screen.

12. Ako po si Maico. nakangiting sabi niya.

13. Wala akong maisip, ikaw na magisip ng topic!

14. Los héroes son fuentes de esperanza y fortaleza en tiempos difíciles.

15. Bantulot niyang binawi ang balde, nakatingin pa rin kay Ogor.

16. Nagsisilbi siya bilang chef upang magluto ng masarap na pagkain para sa kanyang mga kustomer.

17. Amazon has a vast customer base, with millions of customers worldwide.

18. Ang mga mag-aaral ay nag-aapuhap ng karagdagang oras para mag-ensayo para sa kanilang mga pagsusulit.

19. Online gambling er blevet mere populært i de seneste år og giver mulighed for at spille fra komforten af ens eget hjem.

20. Kahit malilimutin si Mia, sinisikap niyang ayusin ang kanyang schedule para maging maayos ang kanyang araw.

21. He is taking a walk in the park.

22. Les personnes âgées peuvent vivre seules ou avec leur famille ou dans des maisons de retraite.

23. Más vale prevenir que lamentar.

24. Dahil ika-50 anibersaryo nila.

25. Magkano ang tiket papuntang Calamba?

26. When we read books, we have to use our intelligence and imagination.

27. Holy Week begins on Palm Sunday, which marks Jesus' triumphal entry into Jerusalem and the start of the Passion narrative.

28. I have been jogging every day for a week.

29. People can also borrow money through loans, credit cards, and other forms of debt.

30. Kumaripas ang delivery rider para maihatid ang order sa takdang oras.

31. Burning bridges with your ex might feel good in the moment, but it can have negative consequences in the long run.

32. The company used the acquired assets to upgrade its technology.

33. Los powerbanks también son útiles para actividades al aire libre, como acampar o hacer senderismo, donde no hay acceso a la electricidad.

34. Sa eroplano, hinde ko mapilitang hinde malungkot.

35. His unique blend of musical styles, charismatic stage presence, and undeniable talent have cemented his place in the pantheon of American music icons

36. Viruses consist of genetic material, either DNA or RNA, surrounded by a protein coat.

37. Gayunpaman, ang kapintasang iyon ay hindi nakikita ng mga tao dahil sa kagandahag loob na ipina mamalas ng mag-asawa.

38. The restaurant was full, and therefore we had to wait for a table.

39. Børn er en vigtig del af samfundet og vores fremtid.

40. Oy bawal PDA dito! natatawang sabi ni Lana.

41. Tinaas ko yung isang kilay ko, I'm working for him noh.

42. Where there's smoke, there's fire.

43. En invierno, se encienden chimeneas y estufas para mantener el calor en las casas.

44. Este aderezo tiene un sabor picante y cítrico que lo hace delicioso.

45. Ano ang ipinabalik mo sa waiter?

46. Ilang tao ang nahulugan ng bato?

47. Hindi ko maipaliwanag ang aking agam-agam sa magiging resulta ng aking pagsusulit.

48. Linggo ng umaga at ang palengke ay siksikan.

49. He has bought a new car.

50. Tumigil muna kami sa harap ng tarangkahan bago pumasok sa simbahan.

Similar Words

matangkadtumatanglawmatanggapmatangosmatangumpaymatanglawin

Recent Searches

roonsobraboyetmatangpromotingoftehelpfulreportidea:surgerycommunicationspaghettiitimpaslitinalalayanmatabaneedsdiniabstainingmalimittvschesselectionformbeforestateparatingtaleinilinglimitformaupworkhimtelevisedimproverightconsiderardinalacandidatetiposcomunicarseelectgapreallyheftymasterpracticesryaninternapersistent,circlefouractivitywebsiteprotestafacerelevantcornerpresidentesourcesolidifyulingleadbituincurrentcreateshiftrepresentativehateevolvedmessagesalapiemphasizedpublishedvanexplainreftinatanongbayadnakalagaylobbypagimbaykanluranwalkie-talkieyoungeasytatagalginugunitapoongjejutumamismagsisimulahinalungkatreorganizinggrocerynaglabatransportationelenaritotshirtstocksboarddemocraticchavitsumarapibonsumabogfindsuccesswikapagngitimakikipag-duetonagmungkahimalapitanjuankahaponinterests,samakatuwidpakakatandaanaraw-padergaanotatlongnagnakawmangkukulamanjoadvertising,nakakunot-noongtinigactornagpaiyakfotosmagpapabunotpamburapinagpatuloyricamakikitulogpacienciamahiyatinaymasaksihanhawlanegosyotinikmakatarungangpanaynahuhumalingerlindamagbayadfilmtatawagmananakawexhaustionkatuwaannaiyaknageespadahannaglakadnakangisimaghahabipumayagnapatigilpagsahodsasakyanhagdananmaghihintaymabagalpakukuluannasagutanpaparusahangospelhigantecarriessumalakaynilaospapalapitkargahankapataganpakiramdamgatolmatutongaayusinroofstockmaibigayumupokagabihumalakhaknakakapuntaeconomicnanigasescuelasdumilatnapakaalatmabibingiitinulosanunggloriabibilipresencebayaningrenaia